Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L0G7

Protein Details
Accession A0A367L0G7    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-35TSPERIYKKSFNKANKKTIAHydrophilic
NLS Segment(s)
PositionSequence
23-60KKSFNKANKKTIAPNLPRLRKLHKGIPILIDRKAPRKR
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences GYKEAIKFFPEEKRLTSPERIYKKSFNKANKKTIAPNLPRLRKLHKGIPILIDRKAPRKRLSLRQLTFIVDLTLNFGRISLKSLIMLAFLDTSAETNILTASAARDLNLEYRPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.5
4 0.49
5 0.53
6 0.58
7 0.59
8 0.58
9 0.63
10 0.67
11 0.69
12 0.69
13 0.7
14 0.73
15 0.76
16 0.8
17 0.77
18 0.73
19 0.7
20 0.7
21 0.69
22 0.63
23 0.65
24 0.65
25 0.64
26 0.64
27 0.61
28 0.59
29 0.57
30 0.57
31 0.53
32 0.51
33 0.49
34 0.47
35 0.48
36 0.48
37 0.41
38 0.38
39 0.36
40 0.3
41 0.35
42 0.39
43 0.39
44 0.37
45 0.43
46 0.48
47 0.54
48 0.61
49 0.63
50 0.59
51 0.59
52 0.57
53 0.5
54 0.44
55 0.34
56 0.26
57 0.15
58 0.14
59 0.12
60 0.11
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.13
67 0.11
68 0.11
69 0.11
70 0.12
71 0.12
72 0.11
73 0.11
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.06
85 0.05
86 0.06
87 0.05
88 0.06
89 0.09
90 0.1
91 0.1
92 0.11
93 0.12
94 0.16