Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LI14

Protein Details
Accession A0A367LI14    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-57IGRHLLSRKRREERRPNETLBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 10.333, cyto 6.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MILFGRRFCDYRSSPDLVTMSDDDEGKQTESRNTVCIIGRHLLSRKRREERRPNETLSPWRSMGWPFSHFRCVVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.4
4 0.31
5 0.31
6 0.24
7 0.19
8 0.16
9 0.16
10 0.12
11 0.13
12 0.13
13 0.11
14 0.12
15 0.12
16 0.13
17 0.16
18 0.17
19 0.17
20 0.16
21 0.17
22 0.17
23 0.17
24 0.17
25 0.15
26 0.15
27 0.16
28 0.2
29 0.25
30 0.31
31 0.39
32 0.46
33 0.53
34 0.62
35 0.7
36 0.77
37 0.8
38 0.8
39 0.78
40 0.74
41 0.71
42 0.68
43 0.66
44 0.59
45 0.54
46 0.46
47 0.41
48 0.38
49 0.34
50 0.34
51 0.3
52 0.3
53 0.3
54 0.33
55 0.39