Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LAQ1

Protein Details
Accession A0A367LAQ1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
22-45ASSARIKKNKKSSNVKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
24-32SARIKKNKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKARFIEICRRKDASSARIKKNKKSSNVKFKVRCQRHLYTLVLKDTDKAEKLKQSLPPNLHITDLSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.5
4 0.49
5 0.52
6 0.49
7 0.52
8 0.53
9 0.5
10 0.51
11 0.56
12 0.6
13 0.66
14 0.69
15 0.71
16 0.76
17 0.74
18 0.73
19 0.75
20 0.75
21 0.78
22 0.82
23 0.83
24 0.78
25 0.79
26 0.8
27 0.75
28 0.72
29 0.68
30 0.64
31 0.6
32 0.58
33 0.53
34 0.49
35 0.47
36 0.41
37 0.36
38 0.32
39 0.28
40 0.26
41 0.26
42 0.22
43 0.21
44 0.23
45 0.27
46 0.31
47 0.35
48 0.4
49 0.44
50 0.49
51 0.5
52 0.52
53 0.51
54 0.49
55 0.45
56 0.39
57 0.36