Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L360

Protein Details
Accession A0A367L360    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-116KSSLRKGCTTRARKKKTPSPSVPIMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 5, pero 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MIYRGRHLSISSEVPPLLSTRHNLLSPKAVPLPGLIPVTAGPFHLVGEKVTLHLHYICINNITLSLSFISLFLCCHDRCRPSGWPMDDTTKSSLRKGCTTRARKKKTPSPSVPIMSLCFFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.18
5 0.15
6 0.16
7 0.18
8 0.21
9 0.24
10 0.25
11 0.26
12 0.31
13 0.3
14 0.32
15 0.29
16 0.26
17 0.23
18 0.23
19 0.21
20 0.17
21 0.17
22 0.13
23 0.11
24 0.11
25 0.12
26 0.11
27 0.1
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.1
45 0.11
46 0.11
47 0.09
48 0.09
49 0.09
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.09
61 0.09
62 0.13
63 0.18
64 0.2
65 0.22
66 0.27
67 0.3
68 0.32
69 0.4
70 0.39
71 0.37
72 0.38
73 0.42
74 0.39
75 0.37
76 0.36
77 0.34
78 0.33
79 0.34
80 0.35
81 0.33
82 0.39
83 0.41
84 0.46
85 0.51
86 0.6
87 0.67
88 0.74
89 0.79
90 0.8
91 0.86
92 0.86
93 0.86
94 0.86
95 0.84
96 0.81
97 0.8
98 0.76
99 0.68
100 0.61
101 0.54