Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LPQ5

Protein Details
Accession A0A367LPQ5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-51EGIVKNKEAKEKKKKEKEKEKHKEKNRYWIPEBasic
NLS Segment(s)
PositionSequence
25-46NKEAKEKKKKEKEKEKHKEKNR
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MRLNRIKIPAGWEKLGLLCEGIVKNKEAKEKKKKEKEKEKHKEKNRYWIPERRSVGSVCNKPASFLERQSSYTYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.23
4 0.15
5 0.1
6 0.11
7 0.12
8 0.14
9 0.13
10 0.14
11 0.18
12 0.2
13 0.29
14 0.34
15 0.43
16 0.52
17 0.61
18 0.71
19 0.78
20 0.85
21 0.87
22 0.91
23 0.91
24 0.91
25 0.92
26 0.92
27 0.91
28 0.91
29 0.91
30 0.84
31 0.84
32 0.81
33 0.79
34 0.75
35 0.73
36 0.69
37 0.67
38 0.67
39 0.59
40 0.53
41 0.45
42 0.46
43 0.47
44 0.46
45 0.41
46 0.45
47 0.41
48 0.41
49 0.42
50 0.4
51 0.35
52 0.35
53 0.37
54 0.33
55 0.36