Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LQ99

Protein Details
Accession A0A367LQ99   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-116LRPAADRPPPRQRRRKRRRNAGPGPDSSBasic
NLS Segment(s)
PositionSequence
93-109ADRPPPRQRRRKRRRNA
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR041373  RT_RNaseH  
Pfam View protein in Pfam  
PF17917  RT_RNaseH  
Amino Acid Sequences MASPSQVTDYPRLTDTPPSEFSTTMPRFQLTSDIPRTIRHYSDAHLLCSCGKRKAAQSRFFEDICPRRQTAPPPPPPEDTSLRAGQEILRPAADRPPPRQRRRKRRRNAGPGPDSSSGTGTDTATTNPTNPPPAPASPAEANYDATKRECKAVLCAMRRLRLHIYGVHFFLETDARVLRKKEKDPTYDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.33
4 0.34
5 0.35
6 0.35
7 0.34
8 0.33
9 0.36
10 0.35
11 0.33
12 0.31
13 0.27
14 0.26
15 0.26
16 0.32
17 0.25
18 0.31
19 0.32
20 0.34
21 0.34
22 0.37
23 0.41
24 0.39
25 0.36
26 0.32
27 0.29
28 0.27
29 0.35
30 0.34
31 0.31
32 0.28
33 0.27
34 0.26
35 0.3
36 0.31
37 0.25
38 0.25
39 0.27
40 0.35
41 0.45
42 0.51
43 0.54
44 0.57
45 0.58
46 0.61
47 0.57
48 0.51
49 0.48
50 0.45
51 0.41
52 0.39
53 0.35
54 0.34
55 0.37
56 0.41
57 0.44
58 0.48
59 0.51
60 0.54
61 0.57
62 0.57
63 0.56
64 0.54
65 0.47
66 0.4
67 0.36
68 0.31
69 0.28
70 0.25
71 0.23
72 0.19
73 0.18
74 0.17
75 0.13
76 0.12
77 0.12
78 0.12
79 0.17
80 0.21
81 0.21
82 0.25
83 0.36
84 0.45
85 0.55
86 0.65
87 0.7
88 0.77
89 0.85
90 0.9
91 0.9
92 0.92
93 0.93
94 0.94
95 0.93
96 0.92
97 0.86
98 0.78
99 0.73
100 0.63
101 0.53
102 0.42
103 0.33
104 0.23
105 0.18
106 0.16
107 0.11
108 0.1
109 0.1
110 0.1
111 0.11
112 0.11
113 0.11
114 0.12
115 0.14
116 0.17
117 0.17
118 0.19
119 0.21
120 0.21
121 0.24
122 0.22
123 0.26
124 0.24
125 0.25
126 0.25
127 0.23
128 0.23
129 0.22
130 0.22
131 0.19
132 0.19
133 0.21
134 0.19
135 0.22
136 0.23
137 0.22
138 0.26
139 0.33
140 0.39
141 0.4
142 0.47
143 0.48
144 0.52
145 0.52
146 0.52
147 0.47
148 0.43
149 0.42
150 0.39
151 0.4
152 0.37
153 0.37
154 0.34
155 0.29
156 0.25
157 0.24
158 0.2
159 0.15
160 0.13
161 0.14
162 0.16
163 0.2
164 0.24
165 0.32
166 0.38
167 0.46
168 0.54
169 0.6