Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LIH3

Protein Details
Accession A0A367LIH3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-187YSPTMVAKRKSRRQSKEQLAMTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MAPVKASRNGAGDDHRPETGAGAGVGAGPGAASAGGGGGGTGGGPKERAVGAAASASASASASASASASASASAAAATPPAPSKMRRAASQTNMSQLVREAAAAPTSAPAPSQDAVNVVAPTVRFCTSPFSPFLRIRLADLLNAPSSFSSSYHQRVLSQPGSIGLYSPTMVAKRKSRRQSKEQLAMTVRKHFNGMGIQENDVMVDFMYRVRCERASSTSPHNKDSRNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.3
5 0.27
6 0.23
7 0.18
8 0.12
9 0.09
10 0.09
11 0.08
12 0.08
13 0.06
14 0.04
15 0.03
16 0.03
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.04
31 0.05
32 0.05
33 0.07
34 0.07
35 0.08
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.08
68 0.1
69 0.12
70 0.17
71 0.25
72 0.28
73 0.3
74 0.36
75 0.4
76 0.44
77 0.5
78 0.45
79 0.41
80 0.4
81 0.38
82 0.31
83 0.24
84 0.19
85 0.12
86 0.11
87 0.08
88 0.06
89 0.07
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.05
96 0.05
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.09
103 0.1
104 0.09
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.08
111 0.08
112 0.08
113 0.14
114 0.15
115 0.17
116 0.19
117 0.21
118 0.25
119 0.26
120 0.28
121 0.27
122 0.25
123 0.25
124 0.26
125 0.23
126 0.19
127 0.19
128 0.19
129 0.16
130 0.15
131 0.14
132 0.09
133 0.1
134 0.1
135 0.09
136 0.1
137 0.14
138 0.18
139 0.21
140 0.22
141 0.23
142 0.25
143 0.31
144 0.29
145 0.25
146 0.22
147 0.2
148 0.21
149 0.19
150 0.16
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.1
157 0.14
158 0.18
159 0.27
160 0.36
161 0.45
162 0.55
163 0.65
164 0.71
165 0.78
166 0.83
167 0.85
168 0.85
169 0.78
170 0.75
171 0.7
172 0.68
173 0.61
174 0.6
175 0.51
176 0.42
177 0.41
178 0.34
179 0.32
180 0.3
181 0.3
182 0.28
183 0.28
184 0.28
185 0.28
186 0.27
187 0.23
188 0.19
189 0.16
190 0.08
191 0.07
192 0.06
193 0.08
194 0.11
195 0.12
196 0.15
197 0.19
198 0.2
199 0.24
200 0.28
201 0.33
202 0.35
203 0.39
204 0.47
205 0.53
206 0.55
207 0.58
208 0.59