FuNGI

A0A367LC36

Protein Details

Accession

A0A367LC36

Localization Confidence

Low

Confidence Score

9.3

NoLS Segment(s)

Position	Sequence	Protein Nature
59-83	VGEVAGEKSRRRRWKPARDFTPDML	Hydrophilic

NLS Segment(s)

Position	Sequence
67-73	SRRRRWK

Subcellular Location(s)

cyto 12.5, cyto_nucl 9, nucl 4.5, mito 4, extr 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR000878 4pyrrol_Mease IPR035996 4pyrrol_Methylase_sf IPR014777 4pyrrole_Mease_sub1 IPR014776 4pyrrole_Mease_sub2 IPR006366 CobA/CysG_C IPR012066 Met1_fungi IPR036291 NAD(P)-bd_dom_sf IPR028281 Sirohaem_synthase_central
Gene Ontology	GO:0016491 F:oxidoreductase activity GO:0004851 F:uroporphyrin-III C-methyltransferase activity GO:0032259 P:methylation GO:0019354 P:siroheme biosynthetic process GO:0000103 P:sulfate assimilation
Pfam	View protein in Pfam PF13241 NAD_binding_7 PF14824 Sirohm_synth_M PF00590 TP_methylase
CDD	cd11642 SUMT

Amino Acid Sequences

MSSSSLLASLSCKDNVHVIIGNDGVAKTRCRQSASAGAHPILVSDLPPDDYDDDGDDGVGEVAGEKSRRRRWKPARDFTPDMLFSLGRHEVNHTVDAVFISLPRDAKVEAMARTCRRNRIPVNVVDSPDLCTFSLLSVYTDGPLQVGVTTNGHGCRLAVRVRRHLASQLPGGLGQAVLRRLILAGSGPGHPSLLTIATVEAIRKADVILADKLVPSPVLDLIPRRTPVQIARKFPGNAQAAQAELLEEALHHVQRGKTVVRLKQGDPYLYGRGADELSWFRDRGLGHRVLVLPGLTSAFAAPLFASVPVTQRDLAHQVLVCTGTGQKGAPTPPPEYVQGRTVVFLMALHRIQSLVDELTASTGEKGKTEEEKSPPQQAPSPPWPPSTPCAVIERASCPDQRIIRTSLSNVVEAVRQEGSRPPGLLVLGAVCEALYTPDPHTPWTVDDGFRQLDDFDALQFQLDHCPDIALMSRSKTFVMLCVAMS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.24
3	0.25
4	0.25
5	0.22
6	0.23
7	0.22
8	0.22
9	0.18
10	0.17
11	0.17
12	0.16
13	0.18
14	0.21
15	0.28
16	0.32
17	0.35
18	0.37
19	0.4
20	0.48
21	0.52
22	0.53
23	0.5
24	0.47
25	0.43
26	0.41
27	0.35
28	0.26
29	0.19
30	0.12
31	0.1
32	0.1
33	0.11
34	0.11
35	0.13
36	0.13
37	0.14
38	0.15
39	0.15
40	0.15
41	0.13
42	0.13
43	0.1
44	0.09
45	0.08
46	0.07
47	0.05
48	0.04
49	0.06
50	0.08
51	0.1
52	0.14
53	0.23
54	0.33
55	0.44
56	0.51
57	0.62
58	0.7
59	0.8
60	0.87
61	0.89
62	0.89
63	0.88
64	0.86
65	0.79
66	0.76
67	0.65
68	0.54
69	0.45
70	0.35
71	0.26
72	0.26
73	0.25
74	0.17
75	0.18
76	0.2
77	0.22
78	0.25
79	0.26
80	0.21
81	0.18
82	0.18
83	0.17
84	0.15
85	0.1
86	0.08
87	0.09
88	0.1
89	0.1
90	0.11
91	0.12
92	0.11
93	0.12
94	0.15
95	0.18
96	0.19
97	0.23
98	0.29
99	0.32
100	0.4
101	0.44
102	0.48
103	0.48
104	0.55
105	0.56
106	0.59
107	0.62
108	0.59
109	0.62
110	0.57
111	0.55
112	0.47
113	0.42
114	0.36
115	0.3
116	0.26
117	0.18
118	0.14
119	0.13
120	0.11
121	0.13
122	0.09
123	0.09
124	0.09
125	0.09
126	0.09
127	0.09
128	0.09
129	0.07
130	0.07
131	0.06
132	0.05
133	0.06
134	0.07
135	0.07
136	0.08
137	0.1
138	0.1
139	0.11
140	0.1
141	0.09
142	0.1
143	0.13
144	0.19
145	0.24
146	0.29
147	0.36
148	0.4
149	0.41
150	0.41
151	0.42
152	0.39
153	0.35
154	0.32
155	0.26
156	0.22
157	0.21
158	0.2
159	0.16
160	0.12
161	0.09
162	0.09
163	0.08
164	0.08
165	0.07
166	0.07
167	0.07
168	0.07
169	0.06
170	0.05
171	0.05
172	0.06
173	0.07
174	0.08
175	0.08
176	0.08
177	0.08
178	0.08
179	0.07
180	0.06
181	0.06
182	0.05
183	0.05
184	0.06
185	0.06
186	0.06
187	0.07
188	0.07
189	0.07
190	0.06
191	0.06
192	0.07
193	0.08
194	0.1
195	0.1
196	0.1
197	0.1
198	0.1
199	0.1
200	0.09
201	0.08
202	0.05
203	0.06
204	0.06
205	0.06
206	0.07
207	0.09
208	0.12
209	0.15
210	0.16
211	0.16
212	0.16
213	0.17
214	0.23
215	0.32
216	0.35
217	0.37
218	0.38
219	0.42
220	0.42
221	0.4
222	0.42
223	0.34
224	0.28
225	0.25
226	0.23
227	0.18
228	0.18
229	0.17
230	0.09
231	0.06
232	0.05
233	0.04
234	0.03
235	0.04
236	0.05
237	0.05
238	0.05
239	0.07
240	0.08
241	0.09
242	0.12
243	0.12
244	0.16
245	0.22
246	0.26
247	0.3
248	0.34
249	0.33
250	0.37
251	0.38
252	0.33
253	0.3
254	0.29
255	0.25
256	0.21
257	0.21
258	0.15
259	0.14
260	0.13
261	0.11
262	0.1
263	0.09
264	0.12
265	0.13
266	0.13
267	0.12
268	0.15
269	0.15
270	0.16
271	0.21
272	0.2
273	0.19
274	0.22
275	0.23
276	0.2
277	0.2
278	0.17
279	0.1
280	0.08
281	0.08
282	0.05
283	0.05
284	0.05
285	0.04
286	0.04
287	0.04
288	0.04
289	0.04
290	0.04
291	0.04
292	0.06
293	0.06
294	0.08
295	0.1
296	0.11
297	0.12
298	0.12
299	0.14
300	0.16
301	0.16
302	0.16
303	0.15
304	0.14
305	0.14
306	0.14
307	0.12
308	0.09
309	0.09
310	0.08
311	0.08
312	0.08
313	0.08
314	0.11
315	0.13
316	0.17
317	0.2
318	0.21
319	0.23
320	0.25
321	0.28
322	0.28
323	0.28
324	0.26
325	0.26
326	0.24
327	0.22
328	0.2
329	0.17
330	0.14
331	0.12
332	0.11
333	0.11
334	0.11
335	0.11
336	0.1
337	0.1
338	0.1
339	0.1
340	0.11
341	0.08
342	0.07
343	0.07
344	0.07
345	0.08
346	0.08
347	0.08
348	0.07
349	0.1
350	0.1
351	0.11
352	0.13
353	0.15
354	0.21
355	0.24
356	0.3
357	0.33
358	0.42
359	0.45
360	0.52
361	0.5
362	0.47
363	0.5
364	0.48
365	0.5
366	0.49
367	0.52
368	0.46
369	0.48
370	0.47
371	0.45
372	0.43
373	0.42
374	0.37
375	0.32
376	0.33
377	0.32
378	0.32
379	0.31
380	0.31
381	0.28
382	0.29
383	0.28
384	0.26
385	0.31
386	0.33
387	0.35
388	0.36
389	0.35
390	0.36
391	0.37
392	0.36
393	0.37
394	0.34
395	0.31
396	0.27
397	0.24
398	0.23
399	0.21
400	0.21
401	0.16
402	0.14
403	0.15
404	0.2
405	0.23
406	0.24
407	0.24
408	0.22
409	0.22
410	0.22
411	0.21
412	0.16
413	0.12
414	0.1
415	0.09
416	0.08
417	0.06
418	0.05
419	0.05
420	0.07
421	0.08
422	0.09
423	0.12
424	0.17
425	0.18
426	0.2
427	0.23
428	0.23
429	0.23
430	0.28
431	0.29
432	0.26
433	0.28
434	0.3
435	0.29
436	0.27
437	0.26
438	0.2
439	0.17
440	0.18
441	0.16
442	0.12
443	0.13
444	0.12
445	0.12
446	0.13
447	0.12
448	0.17
449	0.18
450	0.18
451	0.16
452	0.17
453	0.16
454	0.17
455	0.21
456	0.17
457	0.19
458	0.21
459	0.24
460	0.24
461	0.25
462	0.25
463	0.21
464	0.21
465	0.24

A0A367LC36

3D AlphaFold-predicted Structure Viewer