Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LMQ6

Protein Details
Accession A0A367LMQ6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-80YIHFATLKPEQKKKKKDKKDKKKEKKGKDNGASAABasic
NLS Segment(s)
PositionSequence
55-83EQKKKKKDKKDKKKEKKGKDNGASAAGRK
Subcellular Location(s) cyto 9.5, extr 7, cyto_nucl 6.5, E.R. 4, vacu 3, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPNFDFLKSIGATKEAIAVLNDQPNVFATIIAVLIGLGLELLLLWYIHFATLKPEQKKKKKDKKDKKKEKKGKDNGASAAGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.13
4 0.12
5 0.14
6 0.15
7 0.18
8 0.18
9 0.15
10 0.15
11 0.15
12 0.16
13 0.14
14 0.11
15 0.07
16 0.07
17 0.07
18 0.07
19 0.06
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.01
27 0.01
28 0.01
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.04
37 0.08
38 0.16
39 0.24
40 0.3
41 0.38
42 0.49
43 0.58
44 0.69
45 0.77
46 0.8
47 0.84
48 0.9
49 0.93
50 0.94
51 0.96
52 0.97
53 0.97
54 0.97
55 0.97
56 0.97
57 0.96
58 0.96
59 0.95
60 0.92
61 0.88
62 0.8
63 0.76