Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LBV6

Protein Details
Accession A0A367LBV6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-74EGDHVIEKKKRNHKVRKADANNSSKBasic
NLS Segment(s)
PositionSequence
57-66KKKRNHKVRK
Subcellular Location(s) nucl 15, mito 10.5, cyto_mito 6.5
Family & Domain DBs
Amino Acid Sequences RKRKFCREKWVCLLKSVGRDGPNEVICRAKGEEEGGKKEVKIDEKLTNREGDHVIEKKKRNHKVRKADANNSSKYFSRYFKVPTCSTLTYLYKIGDLEEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.55
3 0.5
4 0.44
5 0.36
6 0.36
7 0.36
8 0.36
9 0.36
10 0.31
11 0.28
12 0.26
13 0.24
14 0.25
15 0.23
16 0.18
17 0.15
18 0.16
19 0.21
20 0.22
21 0.26
22 0.25
23 0.25
24 0.24
25 0.26
26 0.26
27 0.24
28 0.23
29 0.23
30 0.29
31 0.33
32 0.37
33 0.35
34 0.34
35 0.31
36 0.29
37 0.26
38 0.2
39 0.2
40 0.21
41 0.25
42 0.3
43 0.35
44 0.42
45 0.5
46 0.58
47 0.64
48 0.71
49 0.76
50 0.8
51 0.85
52 0.88
53 0.86
54 0.85
55 0.84
56 0.8
57 0.74
58 0.65
59 0.57
60 0.48
61 0.44
62 0.39
63 0.32
64 0.29
65 0.29
66 0.33
67 0.37
68 0.43
69 0.41
70 0.41
71 0.45
72 0.43
73 0.41
74 0.42
75 0.38
76 0.34
77 0.35
78 0.31
79 0.26
80 0.24
81 0.22