Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LBD3

Protein Details
Accession A0A367LBD3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-41GLNRGYKTTRRVCKPRPSRTKGHLSKRTHydrophilic
63-86ELLRNSKDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
67-90NSKDKRARKLAKKRLGTFGRAKKK
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKEAPAKTGLAVGLNRGYKTTRRVCKPRPSRTKGHLSKRTAFVREVVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRAKKKVDELQRVIAESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.21
5 0.23
6 0.23
7 0.31
8 0.38
9 0.42
10 0.5
11 0.6
12 0.67
13 0.76
14 0.82
15 0.85
16 0.86
17 0.84
18 0.83
19 0.8
20 0.82
21 0.81
22 0.81
23 0.79
24 0.74
25 0.73
26 0.72
27 0.69
28 0.61
29 0.52
30 0.45
31 0.42
32 0.37
33 0.33
34 0.26
35 0.21
36 0.18
37 0.18
38 0.14
39 0.08
40 0.07
41 0.05
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.1
49 0.14
50 0.2
51 0.26
52 0.29
53 0.36
54 0.36
55 0.43
56 0.5
57 0.52
58 0.53
59 0.58
60 0.64
61 0.69
62 0.79
63 0.83
64 0.84
65 0.86
66 0.82
67 0.81
68 0.76
69 0.72
70 0.71
71 0.7
72 0.71
73 0.67
74 0.65
75 0.59
76 0.63
77 0.63
78 0.63
79 0.63
80 0.58
81 0.62
82 0.62
83 0.59
84 0.53
85 0.5
86 0.43