FuNGI

A0A367KZY3

Protein Details

Accession

A0A367KZY3

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
406-428	SASESDRRSRSSRRKLLKQEEMA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 23, mito 1, pero 1, E.R. 1, golg 1

Family & Domain DBs

InterPro	View protein in InterPro IPR026841 Aur1/Ipt1
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF14378 PAP2_3
CDD	cd03386 PAP2_Aur1_like

Amino Acid Sequences

MALGAVLEPAIVVTLLFGGAWINRRKGEDDWPDSDDDEDYDDDDDEQLDENADGDDAFESRRRSGSSCWSASSSTTLATTELSSVKLSSAEAFRCRRLRFFGWEKAVRSPNTVVFRHRLLSRLLDRFPFLVEAWYWALIYWVYQLGRAFTALTLVDGTVTVARKHALQLIHLEQRLGIFVELPVQKWFLARPLLLHWINRLYSFIHIPGTIFFLVCLFYITTTRRSNAAGPALYEARRRTMAMCNLLAFVIFTLWPCMPPRLLSDADYKGDEAVEAKSYGFVDTVHGSAGESSVWTTNRFCNQYAAMPSLHFGYSLLIGLTVATLPVSGLRWTSWKRIAMATLGMAYPTLILTAIVATANHFLLDAVAGAMVCGLAWQANGLLLNLSVLEDYFLWFLRIHKPVHVSASESDRRSRSSRRKLLKQEEMA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.04
2	0.04
3	0.04
4	0.04
5	0.05
6	0.07
7	0.15
8	0.2
9	0.23
10	0.26
11	0.29
12	0.33
13	0.35
14	0.43
15	0.46
16	0.48
17	0.49
18	0.49
19	0.48
20	0.45
21	0.42
22	0.33
23	0.23
24	0.19
25	0.15
26	0.13
27	0.12
28	0.12
29	0.11
30	0.11
31	0.11
32	0.09
33	0.09
34	0.09
35	0.08
36	0.08
37	0.08
38	0.08
39	0.07
40	0.06
41	0.06
42	0.06
43	0.06
44	0.08
45	0.11
46	0.14
47	0.15
48	0.18
49	0.2
50	0.23
51	0.27
52	0.36
53	0.41
54	0.41
55	0.42
56	0.41
57	0.4
58	0.38
59	0.36
60	0.26
61	0.18
62	0.17
63	0.15
64	0.13
65	0.13
66	0.12
67	0.11
68	0.11
69	0.11
70	0.11
71	0.11
72	0.11
73	0.11
74	0.11
75	0.11
76	0.15
77	0.17
78	0.24
79	0.27
80	0.34
81	0.4
82	0.42
83	0.43
84	0.45
85	0.46
86	0.48
87	0.53
88	0.55
89	0.57
90	0.6
91	0.59
92	0.6
93	0.61
94	0.53
95	0.49
96	0.43
97	0.41
98	0.42
99	0.41
100	0.38
101	0.35
102	0.36
103	0.36
104	0.34
105	0.3
106	0.25
107	0.31
108	0.34
109	0.36
110	0.36
111	0.34
112	0.34
113	0.32
114	0.3
115	0.24
116	0.17
117	0.14
118	0.12
119	0.13
120	0.13
121	0.13
122	0.12
123	0.1
124	0.1
125	0.08
126	0.08
127	0.06
128	0.08
129	0.08
130	0.09
131	0.1
132	0.1
133	0.11
134	0.11
135	0.1
136	0.07
137	0.09
138	0.07
139	0.07
140	0.06
141	0.06
142	0.05
143	0.05
144	0.06
145	0.07
146	0.08
147	0.08
148	0.08
149	0.09
150	0.09
151	0.1
152	0.14
153	0.12
154	0.12
155	0.17
156	0.21
157	0.25
158	0.25
159	0.24
160	0.2
161	0.2
162	0.19
163	0.15
164	0.1
165	0.05
166	0.05
167	0.11
168	0.11
169	0.12
170	0.12
171	0.12
172	0.13
173	0.13
174	0.13
175	0.1
176	0.12
177	0.11
178	0.12
179	0.13
180	0.2
181	0.2
182	0.21
183	0.19
184	0.19
185	0.2
186	0.19
187	0.17
188	0.11
189	0.12
190	0.12
191	0.12
192	0.1
193	0.09
194	0.09
195	0.09
196	0.1
197	0.09
198	0.08
199	0.07
200	0.06
201	0.07
202	0.07
203	0.07
204	0.04
205	0.05
206	0.07
207	0.09
208	0.14
209	0.15
210	0.16
211	0.16
212	0.18
213	0.19
214	0.2
215	0.22
216	0.17
217	0.17
218	0.18
219	0.19
220	0.18
221	0.2
222	0.17
223	0.16
224	0.16
225	0.16
226	0.16
227	0.21
228	0.25
229	0.26
230	0.26
231	0.24
232	0.23
233	0.23
234	0.2
235	0.13
236	0.08
237	0.05
238	0.04
239	0.04
240	0.06
241	0.06
242	0.07
243	0.09
244	0.1
245	0.1
246	0.11
247	0.14
248	0.16
249	0.17
250	0.18
251	0.22
252	0.24
253	0.25
254	0.24
255	0.21
256	0.17
257	0.16
258	0.14
259	0.09
260	0.08
261	0.08
262	0.08
263	0.07
264	0.08
265	0.09
266	0.09
267	0.08
268	0.07
269	0.08
270	0.09
271	0.09
272	0.08
273	0.08
274	0.08
275	0.07
276	0.08
277	0.05
278	0.04
279	0.05
280	0.08
281	0.09
282	0.1
283	0.12
284	0.16
285	0.22
286	0.25
287	0.25
288	0.25
289	0.26
290	0.29
291	0.3
292	0.28
293	0.23
294	0.2
295	0.2
296	0.18
297	0.17
298	0.12
299	0.1
300	0.08
301	0.08
302	0.08
303	0.08
304	0.06
305	0.06
306	0.05
307	0.05
308	0.04
309	0.04
310	0.03
311	0.03
312	0.03
313	0.04
314	0.06
315	0.06
316	0.07
317	0.08
318	0.15
319	0.18
320	0.25
321	0.3
322	0.32
323	0.34
324	0.35
325	0.36
326	0.31
327	0.29
328	0.24
329	0.19
330	0.16
331	0.14
332	0.11
333	0.09
334	0.07
335	0.06
336	0.05
337	0.04
338	0.04
339	0.04
340	0.04
341	0.05
342	0.05
343	0.05
344	0.06
345	0.08
346	0.08
347	0.08
348	0.07
349	0.07
350	0.07
351	0.07
352	0.06
353	0.04
354	0.05
355	0.04
356	0.04
357	0.04
358	0.04
359	0.03
360	0.03
361	0.03
362	0.03
363	0.03
364	0.04
365	0.04
366	0.06
367	0.06
368	0.07
369	0.07
370	0.06
371	0.07
372	0.06
373	0.07
374	0.05
375	0.05
376	0.06
377	0.06
378	0.07
379	0.08
380	0.08
381	0.1
382	0.1
383	0.13
384	0.2
385	0.25
386	0.26
387	0.3
388	0.34
389	0.37
390	0.42
391	0.41
392	0.36
393	0.35
394	0.43
395	0.44
396	0.42
397	0.45
398	0.42
399	0.46
400	0.48
401	0.55
402	0.57
403	0.62
404	0.69
405	0.74
406	0.82
407	0.87
408	0.92

A0A367KZY3

3D AlphaFold-predicted Structure Viewer