Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LDQ1

Protein Details
Accession A0A367LDQ1    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-40GSSQSRPSTRPLRQQTRRKMKPNRCSPRSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 9.833, nucl 5, cyto_nucl 3.833, golg 3, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDGWMKGQLSGSSQSRPSTRPLRQQTRRKMKPNRCSPRSASAALLVWSLGVIDNKDPIQSVQWKTFNIGLILSFPPHLFRLPFICTLQATSIDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.31
4 0.35
5 0.39
6 0.43
7 0.49
8 0.58
9 0.65
10 0.72
11 0.81
12 0.85
13 0.87
14 0.89
15 0.89
16 0.9
17 0.89
18 0.89
19 0.9
20 0.9
21 0.83
22 0.8
23 0.74
24 0.71
25 0.64
26 0.55
27 0.45
28 0.35
29 0.32
30 0.26
31 0.21
32 0.13
33 0.08
34 0.07
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.1
46 0.17
47 0.2
48 0.25
49 0.28
50 0.28
51 0.3
52 0.32
53 0.29
54 0.23
55 0.2
56 0.14
57 0.14
58 0.14
59 0.13
60 0.11
61 0.1
62 0.12
63 0.13
64 0.14
65 0.12
66 0.14
67 0.18
68 0.21
69 0.24
70 0.24
71 0.25
72 0.24
73 0.25
74 0.25