FuNGI

A0A367LAX2

Protein Details

Accession

A0A367LAX2

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
661-686	EEEEGKKKPKAEEKAKKEEEKPKTEE	Acidic

NLS Segment(s)

Position	Sequence
579-691	KAKFVSNEGKPNKAGKEARPDEKAKAGEKPKTEEKTVKDEQKSNKEEKPKTAETAKKTEEKPKTEETAKKTEEKPKAGEKAKEEEEGKKKPKAEEKAKKEEEKPKTEEKTVKP

Subcellular Location(s)

cyto 12.5, cyto_nucl 9.5, mito 8, nucl 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR000627 Intradiol_dOase_C IPR015889 Intradiol_dOase_core IPR036291 NAD(P)-bd_dom_sf IPR002347 SDR_fam
Gene Ontology	GO:0008199 F:ferric iron binding GO:0016702 F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen GO:0006725 P:cellular aromatic compound metabolic process
Pfam	View protein in Pfam PF13561 adh_short_C2 PF00775 Dioxygenase_C
CDD	cd03457 intradiol_dioxygenase_like cd05233 SDR_c

Amino Acid Sequences

MANKLSPPIRSHSPPGADDKVVAVITGANSPTGIGRAAARRMAETGRLRALYICDRDGEHLDAQAEELASLPGSGSVDVHVRRFDAADEDGVRAVVGDAMGRYGRLDVFVANAGVTGRYRAFTDVSCDEFMAVMRVNALSVFLAAKHAAPAMRKTSTEKARPGGSIVATASVAGLRANAGPTAYSASKAAVVSMAQTMAYQLVGSGVRINAVCPGLIQTGMTAPLWDAARARGTQGKIGQLNPMLRAGQADEVARVVVFLAVWPCMGTLAHPKSAEETKAALEIRSIVTVHSRNEIEKCANSPGATALKNRAVSPLVRRADKKALEKWSAVSHGVSFRQGLATPKEVLFASNFTNTLTPETIIGPYFVEDERIRHDIREGQPGIRTKLDFQFIDIHTCKPIPHLIIDVWHANATGVYSGVTGAGQGGLATTFGRGVQVTDGDGVVQFDTVFPGHYVGRASHFHVMSTDGSGGTARHIGQTYMDDALVKAVRALPPYSSNRQAWTPNAEDEFAADEATPEYDPFMKYVYLGESLDDGLLMWTTIGIDPKADYSRHRSAAARWRPEGAIDLTAKPSGPEHKAKFVSNEGKPNKAGKEARPDEKAKAGEKPKTEEKTVKDEQKSNKEEKPKTAETAKKTEEKPKTEETAKKTEEKPKAGEKAKEEEEGKKKPKAEEKAKKEEEKPKTEEKTVKP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.56
3	0.54
4	0.47
5	0.42
6	0.37
7	0.32
8	0.27
9	0.23
10	0.15
11	0.12
12	0.12
13	0.15
14	0.13
15	0.1
16	0.1
17	0.11
18	0.11
19	0.11
20	0.1
21	0.08
22	0.13
23	0.18
24	0.22
25	0.25
26	0.25
27	0.25
28	0.28
29	0.29
30	0.33
31	0.33
32	0.34
33	0.37
34	0.36
35	0.35
36	0.34
37	0.37
38	0.37
39	0.35
40	0.32
41	0.28
42	0.28
43	0.31
44	0.33
45	0.32
46	0.25
47	0.23
48	0.22
49	0.21
50	0.2
51	0.18
52	0.15
53	0.11
54	0.1
55	0.08
56	0.07
57	0.07
58	0.06
59	0.06
60	0.07
61	0.07
62	0.06
63	0.08
64	0.13
65	0.15
66	0.17
67	0.17
68	0.17
69	0.18
70	0.19
71	0.18
72	0.17
73	0.16
74	0.18
75	0.19
76	0.19
77	0.19
78	0.18
79	0.16
80	0.12
81	0.11
82	0.07
83	0.06
84	0.06
85	0.05
86	0.07
87	0.08
88	0.07
89	0.08
90	0.08
91	0.09
92	0.09
93	0.1
94	0.08
95	0.1
96	0.11
97	0.11
98	0.09
99	0.1
100	0.09
101	0.09
102	0.09
103	0.1
104	0.09
105	0.1
106	0.11
107	0.13
108	0.14
109	0.14
110	0.2
111	0.21
112	0.23
113	0.23
114	0.22
115	0.2
116	0.19
117	0.18
118	0.14
119	0.12
120	0.08
121	0.08
122	0.08
123	0.08
124	0.07
125	0.08
126	0.05
127	0.06
128	0.06
129	0.05
130	0.07
131	0.08
132	0.08
133	0.08
134	0.1
135	0.11
136	0.13
137	0.17
138	0.21
139	0.23
140	0.24
141	0.29
142	0.37
143	0.44
144	0.48
145	0.49
146	0.48
147	0.49
148	0.48
149	0.44
150	0.39
151	0.3
152	0.25
153	0.2
154	0.17
155	0.14
156	0.13
157	0.11
158	0.07
159	0.07
160	0.05
161	0.05
162	0.05
163	0.05
164	0.06
165	0.06
166	0.06
167	0.06
168	0.07
169	0.11
170	0.11
171	0.11
172	0.11
173	0.11
174	0.13
175	0.13
176	0.12
177	0.09
178	0.09
179	0.09
180	0.09
181	0.09
182	0.06
183	0.06
184	0.06
185	0.06
186	0.06
187	0.05
188	0.04
189	0.05
190	0.06
191	0.06
192	0.07
193	0.07
194	0.08
195	0.08
196	0.09
197	0.09
198	0.1
199	0.09
200	0.08
201	0.1
202	0.09
203	0.09
204	0.09
205	0.07
206	0.07
207	0.08
208	0.08
209	0.06
210	0.06
211	0.09
212	0.09
213	0.09
214	0.09
215	0.1
216	0.12
217	0.12
218	0.14
219	0.16
220	0.17
221	0.2
222	0.22
223	0.26
224	0.26
225	0.26
226	0.27
227	0.26
228	0.27
229	0.23
230	0.23
231	0.17
232	0.15
233	0.15
234	0.13
235	0.11
236	0.11
237	0.1
238	0.09
239	0.09
240	0.09
241	0.08
242	0.07
243	0.05
244	0.04
245	0.03
246	0.04
247	0.04
248	0.05
249	0.05
250	0.05
251	0.05
252	0.05
253	0.05
254	0.05
255	0.14
256	0.16
257	0.19
258	0.19
259	0.2
260	0.23
261	0.25
262	0.25
263	0.17
264	0.16
265	0.13
266	0.17
267	0.17
268	0.13
269	0.11
270	0.12
271	0.11
272	0.11
273	0.1
274	0.07
275	0.11
276	0.13
277	0.14
278	0.16
279	0.16
280	0.17
281	0.19
282	0.21
283	0.19
284	0.18
285	0.19
286	0.18
287	0.18
288	0.16
289	0.15
290	0.15
291	0.16
292	0.17
293	0.16
294	0.17
295	0.2
296	0.21
297	0.2
298	0.2
299	0.18
300	0.18
301	0.22
302	0.28
303	0.27
304	0.29
305	0.3
306	0.33
307	0.39
308	0.42
309	0.42
310	0.4
311	0.43
312	0.43
313	0.42
314	0.39
315	0.34
316	0.31
317	0.26
318	0.2
319	0.15
320	0.14
321	0.14
322	0.13
323	0.11
324	0.09
325	0.1
326	0.1
327	0.12
328	0.12
329	0.13
330	0.14
331	0.14
332	0.15
333	0.14
334	0.13
335	0.11
336	0.11
337	0.1
338	0.1
339	0.1
340	0.09
341	0.1
342	0.1
343	0.11
344	0.1
345	0.08
346	0.08
347	0.09
348	0.09
349	0.09
350	0.09
351	0.07
352	0.07
353	0.08
354	0.07
355	0.09
356	0.09
357	0.1
358	0.13
359	0.16
360	0.16
361	0.15
362	0.16
363	0.2
364	0.23
365	0.3
366	0.28
367	0.26
368	0.3
369	0.33
370	0.34
371	0.28
372	0.26
373	0.2
374	0.23
375	0.26
376	0.21
377	0.2
378	0.25
379	0.23
380	0.29
381	0.28
382	0.25
383	0.22
384	0.23
385	0.21
386	0.16
387	0.18
388	0.13
389	0.12
390	0.14
391	0.13
392	0.14
393	0.16
394	0.15
395	0.13
396	0.11
397	0.11
398	0.09
399	0.08
400	0.07
401	0.05
402	0.04
403	0.04
404	0.04
405	0.04
406	0.04
407	0.04
408	0.03
409	0.03
410	0.03
411	0.03
412	0.03
413	0.03
414	0.03
415	0.03
416	0.03
417	0.03
418	0.03
419	0.04
420	0.04
421	0.04
422	0.05
423	0.06
424	0.06
425	0.06
426	0.07
427	0.07
428	0.06
429	0.06
430	0.06
431	0.05
432	0.05
433	0.04
434	0.04
435	0.05
436	0.05
437	0.06
438	0.05
439	0.07
440	0.07
441	0.08
442	0.09
443	0.09
444	0.13
445	0.14
446	0.16
447	0.2
448	0.2
449	0.2
450	0.19
451	0.21
452	0.17
453	0.17
454	0.15
455	0.09
456	0.09
457	0.09
458	0.09
459	0.08
460	0.09
461	0.08
462	0.09
463	0.1
464	0.1
465	0.11
466	0.12
467	0.13
468	0.12
469	0.11
470	0.09
471	0.09
472	0.12
473	0.11
474	0.1
475	0.09
476	0.1
477	0.12
478	0.14
479	0.15
480	0.14
481	0.2
482	0.26
483	0.31
484	0.34
485	0.34
486	0.35
487	0.38
488	0.39
489	0.36
490	0.36
491	0.33
492	0.3
493	0.31
494	0.28
495	0.25
496	0.22
497	0.21
498	0.15
499	0.13
500	0.09
501	0.08
502	0.08
503	0.09
504	0.09
505	0.06
506	0.07
507	0.09
508	0.1
509	0.1
510	0.11
511	0.1
512	0.1
513	0.11
514	0.12
515	0.12
516	0.12
517	0.12
518	0.11
519	0.12
520	0.11
521	0.1
522	0.07
523	0.05
524	0.05
525	0.05
526	0.04
527	0.03
528	0.04
529	0.05
530	0.07
531	0.07
532	0.07
533	0.08
534	0.12
535	0.15
536	0.16
537	0.18
538	0.25
539	0.33
540	0.35
541	0.38
542	0.36
543	0.41
544	0.51
545	0.57
546	0.56
547	0.5
548	0.5
549	0.47
550	0.46
551	0.42
552	0.33
553	0.29
554	0.24
555	0.24
556	0.23
557	0.23
558	0.22
559	0.19
560	0.19
561	0.2
562	0.24
563	0.31
564	0.34
565	0.42
566	0.46
567	0.47
568	0.49
569	0.52
570	0.55
571	0.51
572	0.57
573	0.52
574	0.53
575	0.54
576	0.56
577	0.49
578	0.49
579	0.5
580	0.46
581	0.54
582	0.56
583	0.6
584	0.61
585	0.62
586	0.57
587	0.58
588	0.56
589	0.48
590	0.5
591	0.52
592	0.51
593	0.53
594	0.56
595	0.58
596	0.59
597	0.62
598	0.6
599	0.57
600	0.59
601	0.63
602	0.66
603	0.63
604	0.65
605	0.69
606	0.72
607	0.74
608	0.72
609	0.7
610	0.71
611	0.7
612	0.71
613	0.71
614	0.65
615	0.64
616	0.67
617	0.68
618	0.64
619	0.68
620	0.65
621	0.64
622	0.64
623	0.68
624	0.68
625	0.66
626	0.65
627	0.63
628	0.65
629	0.65
630	0.68
631	0.65
632	0.66
633	0.65
634	0.66
635	0.66
636	0.68
637	0.69
638	0.67
639	0.67
640	0.66
641	0.71
642	0.72
643	0.71
644	0.67
645	0.66
646	0.64
647	0.65
648	0.58
649	0.58
650	0.59
651	0.62
652	0.64
653	0.62
654	0.63
655	0.64
656	0.71
657	0.72
658	0.74
659	0.75
660	0.78
661	0.83
662	0.87
663	0.87
664	0.86
665	0.86
666	0.84
667	0.82
668	0.79
669	0.78
670	0.75
671	0.76

A0A367LAX2

3D AlphaFold-predicted Structure Viewer