Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LLA4

Protein Details
Accession A0A367LLA4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
12-38LITSKGYTSKKKKRNHVIKVRKANANNHydrophilic
NLS Segment(s)
PositionSequence
21-33KKKKRNHVIKVRK
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSIPSQRAEPGLITSKGYTSKKKKRNHVIKVRKANANNSSKYFSRYFKVPTCSTLTYLYTCTCRSDRSDRSDPMIPAMTAMTRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.29
4 0.33
5 0.37
6 0.42
7 0.52
8 0.59
9 0.67
10 0.75
11 0.79
12 0.86
13 0.87
14 0.88
15 0.89
16 0.9
17 0.92
18 0.87
19 0.83
20 0.74
21 0.71
22 0.68
23 0.64
24 0.56
25 0.48
26 0.45
27 0.39
28 0.41
29 0.36
30 0.29
31 0.25
32 0.25
33 0.27
34 0.28
35 0.34
36 0.31
37 0.31
38 0.35
39 0.34
40 0.33
41 0.31
42 0.27
43 0.22
44 0.23
45 0.22
46 0.19
47 0.18
48 0.2
49 0.19
50 0.2
51 0.25
52 0.32
53 0.38
54 0.45
55 0.52
56 0.51
57 0.55
58 0.59
59 0.53
60 0.49
61 0.45
62 0.35
63 0.28
64 0.26
65 0.22