Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L8J9

Protein Details
Accession A0A367L8J9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-46LITSKGYTSKKKKRNHVIKVRKADANHydrophilic
NLS Segment(s)
PositionSequence
30-39KKKKRNHVIK
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences VGKKGPNKVICIPSQRAEPGLITSKGYTSKKKKRNHVIKVRKADANDSSNTLTYLYTCTCRSDRSDRSDPMTPAMTAMTRPLRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.39
4 0.34
5 0.28
6 0.25
7 0.26
8 0.24
9 0.21
10 0.2
11 0.2
12 0.26
13 0.28
14 0.34
15 0.39
16 0.48
17 0.56
18 0.64
19 0.72
20 0.76
21 0.84
22 0.85
23 0.86
24 0.87
25 0.88
26 0.88
27 0.81
28 0.72
29 0.62
30 0.55
31 0.48
32 0.4
33 0.32
34 0.26
35 0.23
36 0.21
37 0.2
38 0.17
39 0.12
40 0.09
41 0.1
42 0.09
43 0.11
44 0.12
45 0.15
46 0.16
47 0.18
48 0.24
49 0.31
50 0.37
51 0.43
52 0.51
53 0.5
54 0.55
55 0.59
56 0.54
57 0.49
58 0.44
59 0.35
60 0.28
61 0.27
62 0.21
63 0.15
64 0.2
65 0.23