Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LGB6

Protein Details
Accession A0A367LGB6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
48-71NWPYRRFCNPIRPGRNRPRPPYSLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, nucl 6.5, cyto_nucl 6.5, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences PSAAPPDRAPGNTIGVPIVIDRGPKGIAQRTRPPFLLLLPVQSRNPSNWPYRRFCNPIRPGRNRPRPPYSLPPLLHYPWDYLSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.16
4 0.14
5 0.13
6 0.09
7 0.09
8 0.08
9 0.09
10 0.1
11 0.11
12 0.14
13 0.2
14 0.25
15 0.31
16 0.4
17 0.44
18 0.46
19 0.46
20 0.44
21 0.37
22 0.32
23 0.32
24 0.23
25 0.22
26 0.21
27 0.22
28 0.21
29 0.21
30 0.21
31 0.17
32 0.2
33 0.2
34 0.26
35 0.32
36 0.37
37 0.41
38 0.45
39 0.5
40 0.53
41 0.54
42 0.56
43 0.58
44 0.63
45 0.69
46 0.72
47 0.76
48 0.81
49 0.87
50 0.85
51 0.84
52 0.81
53 0.77
54 0.77
55 0.76
56 0.73
57 0.71
58 0.63
59 0.6
60 0.58
61 0.53
62 0.5
63 0.41
64 0.36
65 0.29