Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KPZ6

Protein Details
Accession A0A367KPZ6   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
189-209LEEKKRQKEERERREREKKDTBasic
NLS Segment(s)
PositionSequence
179-207KKKAVDRKNMLEEKKRQKEERERREREKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044059  Csn1/TTC4_wheel  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0051879  F:Hsp90 protein binding  
Pfam View protein in Pfam  
PF18972  Wheel  
CDD cd21380  CTWD_Cns1  
Amino Acid Sequences MSETTEQNEPLGPKPYKGQYAMDPDNLDEELSKVPLFMTQLPSEDNDTLDAIQSLVFDGTPEEVALNFKDQGNECFRAGKTKYKDAITFYTRALDTECKDMAIIEACLANRAACNLELQNFGRVLTDCSKCLEINPKNVKALYRSAKALAALDRLLEAIDCCDHALMIDPENKVVHDIKKKAVDRKNMLEEKKRQKEERERREREKKDTLENAFKERNITIQVEDKEVREKANIDYDFETNTINWPVFFLYPEYKESDYIQSFNEMHTFQDHLEIMFEQPAPWDAKQEYNTNSVEVFFEDIRGLNPKLIKIGKKHTLGKILSLDQYIVKNGVPSFIIMPKNSPFKQEFLNKYKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.44
4 0.45
5 0.44
6 0.43
7 0.51
8 0.54
9 0.51
10 0.45
11 0.4
12 0.39
13 0.35
14 0.27
15 0.18
16 0.15
17 0.12
18 0.13
19 0.12
20 0.1
21 0.1
22 0.12
23 0.14
24 0.16
25 0.2
26 0.2
27 0.21
28 0.23
29 0.25
30 0.27
31 0.24
32 0.21
33 0.17
34 0.17
35 0.15
36 0.15
37 0.13
38 0.09
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.05
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.07
51 0.09
52 0.1
53 0.11
54 0.12
55 0.13
56 0.16
57 0.18
58 0.23
59 0.27
60 0.29
61 0.27
62 0.3
63 0.29
64 0.34
65 0.35
66 0.39
67 0.39
68 0.45
69 0.5
70 0.49
71 0.52
72 0.48
73 0.53
74 0.48
75 0.44
76 0.35
77 0.35
78 0.31
79 0.28
80 0.26
81 0.23
82 0.2
83 0.23
84 0.22
85 0.18
86 0.18
87 0.17
88 0.15
89 0.13
90 0.11
91 0.08
92 0.09
93 0.09
94 0.1
95 0.1
96 0.09
97 0.07
98 0.08
99 0.09
100 0.07
101 0.1
102 0.1
103 0.12
104 0.15
105 0.16
106 0.18
107 0.16
108 0.16
109 0.16
110 0.15
111 0.17
112 0.19
113 0.2
114 0.18
115 0.19
116 0.21
117 0.19
118 0.21
119 0.28
120 0.26
121 0.35
122 0.42
123 0.42
124 0.43
125 0.44
126 0.43
127 0.35
128 0.39
129 0.35
130 0.3
131 0.29
132 0.28
133 0.28
134 0.27
135 0.25
136 0.19
137 0.14
138 0.12
139 0.1
140 0.09
141 0.08
142 0.08
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.06
153 0.06
154 0.08
155 0.12
156 0.12
157 0.13
158 0.13
159 0.13
160 0.12
161 0.14
162 0.17
163 0.2
164 0.22
165 0.25
166 0.33
167 0.37
168 0.44
169 0.48
170 0.51
171 0.5
172 0.54
173 0.59
174 0.58
175 0.58
176 0.57
177 0.6
178 0.63
179 0.66
180 0.66
181 0.6
182 0.63
183 0.71
184 0.74
185 0.76
186 0.76
187 0.75
188 0.79
189 0.87
190 0.83
191 0.8
192 0.78
193 0.7
194 0.67
195 0.67
196 0.62
197 0.6
198 0.56
199 0.54
200 0.46
201 0.43
202 0.37
203 0.3
204 0.27
205 0.21
206 0.2
207 0.16
208 0.21
209 0.22
210 0.24
211 0.24
212 0.23
213 0.25
214 0.24
215 0.23
216 0.18
217 0.19
218 0.17
219 0.24
220 0.24
221 0.22
222 0.24
223 0.23
224 0.23
225 0.22
226 0.21
227 0.12
228 0.14
229 0.13
230 0.11
231 0.1
232 0.09
233 0.1
234 0.1
235 0.11
236 0.11
237 0.14
238 0.16
239 0.18
240 0.21
241 0.2
242 0.21
243 0.23
244 0.26
245 0.24
246 0.23
247 0.22
248 0.23
249 0.22
250 0.22
251 0.22
252 0.16
253 0.15
254 0.15
255 0.16
256 0.12
257 0.16
258 0.15
259 0.12
260 0.13
261 0.13
262 0.13
263 0.14
264 0.14
265 0.09
266 0.1
267 0.13
268 0.15
269 0.14
270 0.18
271 0.17
272 0.23
273 0.27
274 0.32
275 0.32
276 0.33
277 0.34
278 0.31
279 0.3
280 0.24
281 0.21
282 0.17
283 0.16
284 0.11
285 0.11
286 0.11
287 0.11
288 0.12
289 0.16
290 0.16
291 0.17
292 0.19
293 0.19
294 0.25
295 0.31
296 0.35
297 0.37
298 0.46
299 0.51
300 0.57
301 0.63
302 0.62
303 0.66
304 0.61
305 0.59
306 0.56
307 0.51
308 0.46
309 0.39
310 0.34
311 0.28
312 0.29
313 0.25
314 0.2
315 0.17
316 0.18
317 0.17
318 0.18
319 0.15
320 0.15
321 0.17
322 0.22
323 0.26
324 0.23
325 0.27
326 0.32
327 0.4
328 0.4
329 0.43
330 0.4
331 0.38
332 0.46
333 0.52
334 0.55