Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KXH7

Protein Details
Accession A0A367KXH7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
54-82SDVVQSFRKEKNRKKEKEKEKKTFNPFALHydrophilic
NLS Segment(s)
PositionSequence
61-75RKEKNRKKEKEKEKK
Subcellular Location(s) mito 14, cyto 8, cyto_nucl 6.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MAVQVESSGNNMNKAKARVYDRPTLLALAGSPFAKVPPVKMAFIPGVTRTPNQSDVVQSFRKEKNRKKEKEKEKKTFNPFALLGDGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.33
4 0.39
5 0.43
6 0.47
7 0.51
8 0.48
9 0.48
10 0.46
11 0.39
12 0.33
13 0.24
14 0.19
15 0.11
16 0.11
17 0.08
18 0.07
19 0.07
20 0.07
21 0.09
22 0.09
23 0.09
24 0.15
25 0.17
26 0.18
27 0.18
28 0.2
29 0.18
30 0.19
31 0.18
32 0.12
33 0.12
34 0.13
35 0.13
36 0.13
37 0.15
38 0.17
39 0.18
40 0.18
41 0.18
42 0.19
43 0.24
44 0.24
45 0.23
46 0.27
47 0.31
48 0.41
49 0.48
50 0.55
51 0.61
52 0.69
53 0.78
54 0.82
55 0.87
56 0.89
57 0.91
58 0.93
59 0.92
60 0.92
61 0.92
62 0.9
63 0.89
64 0.79
65 0.75
66 0.64
67 0.56
68 0.48