Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KM80

Protein Details
Accession A0A367KM80    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
77-96NLPRINRRILTKKQKQSNISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MQSLKVCGSFYFIIFLTPDASKPTCLNYPLSSSEEDIALKNIKQTFGRTPAYTGLYEPEDDGLTRSPVLGTTVPKNNLPRINRRILTKKQKQSNISGFDCDNALNSITSFLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.13
4 0.12
5 0.13
6 0.15
7 0.16
8 0.17
9 0.17
10 0.21
11 0.22
12 0.23
13 0.26
14 0.23
15 0.26
16 0.27
17 0.29
18 0.26
19 0.23
20 0.22
21 0.19
22 0.18
23 0.15
24 0.13
25 0.13
26 0.12
27 0.14
28 0.15
29 0.16
30 0.16
31 0.19
32 0.21
33 0.26
34 0.29
35 0.25
36 0.26
37 0.26
38 0.27
39 0.24
40 0.2
41 0.16
42 0.13
43 0.13
44 0.11
45 0.1
46 0.08
47 0.07
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.08
56 0.09
57 0.11
58 0.15
59 0.21
60 0.22
61 0.26
62 0.29
63 0.32
64 0.37
65 0.4
66 0.45
67 0.46
68 0.53
69 0.53
70 0.58
71 0.61
72 0.64
73 0.71
74 0.71
75 0.74
76 0.75
77 0.8
78 0.77
79 0.78
80 0.76
81 0.73
82 0.65
83 0.58
84 0.49
85 0.42
86 0.38
87 0.29
88 0.21
89 0.15
90 0.14
91 0.11
92 0.11
93 0.13