Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IWC2

Protein Details
Accession A0A367IWC2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
7-26ISSYFTKKPAEKKPRLEGICHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007695  DNA_mismatch_repair_MutS-lik_N  
IPR016151  DNA_mismatch_repair_MutS_N  
IPR036678  MutS_con_dom_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0030983  F:mismatched DNA binding  
GO:0006298  P:mismatch repair  
Pfam View protein in Pfam  
PF01624  MutS_I  
Amino Acid Sequences MKRQSSISSYFTKKPAEKKPRLEGICVNKSRSSQDLEKLHQQFREKLNTMAREKSQKHQDTIIQKQKLTPLEAQVAELKEKYPHCLLLIEVGYKFRFFGEDAKIASRILHIAHFIDRNFYVASIPVHRLNIHVKKLVNAGYRVGIVRQTETAALKAAGSNKSQPFARELDQMITKGTLVDDLLFDTTPTSSGGYLMCLVEEKRGGHASDERVLTGMVAVHPSTGDIIYDAFEDTYMRNELETRLLHIEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.67
4 0.71
5 0.74
6 0.79
7 0.82
8 0.78
9 0.74
10 0.71
11 0.7
12 0.71
13 0.65
14 0.59
15 0.52
16 0.51
17 0.5
18 0.45
19 0.42
20 0.36
21 0.42
22 0.45
23 0.47
24 0.54
25 0.57
26 0.57
27 0.55
28 0.54
29 0.53
30 0.51
31 0.56
32 0.49
33 0.48
34 0.51
35 0.55
36 0.54
37 0.52
38 0.51
39 0.51
40 0.52
41 0.55
42 0.59
43 0.56
44 0.55
45 0.54
46 0.56
47 0.55
48 0.62
49 0.63
50 0.56
51 0.52
52 0.51
53 0.52
54 0.48
55 0.43
56 0.35
57 0.29
58 0.31
59 0.3
60 0.29
61 0.27
62 0.25
63 0.23
64 0.21
65 0.17
66 0.17
67 0.17
68 0.2
69 0.18
70 0.18
71 0.17
72 0.18
73 0.17
74 0.17
75 0.18
76 0.15
77 0.14
78 0.15
79 0.14
80 0.14
81 0.14
82 0.09
83 0.09
84 0.08
85 0.13
86 0.15
87 0.18
88 0.19
89 0.2
90 0.21
91 0.19
92 0.19
93 0.14
94 0.11
95 0.09
96 0.08
97 0.07
98 0.08
99 0.1
100 0.12
101 0.11
102 0.12
103 0.12
104 0.12
105 0.12
106 0.11
107 0.09
108 0.08
109 0.1
110 0.09
111 0.11
112 0.11
113 0.12
114 0.12
115 0.14
116 0.2
117 0.25
118 0.25
119 0.27
120 0.26
121 0.27
122 0.29
123 0.32
124 0.27
125 0.22
126 0.21
127 0.18
128 0.18
129 0.17
130 0.15
131 0.13
132 0.1
133 0.1
134 0.1
135 0.1
136 0.11
137 0.11
138 0.11
139 0.1
140 0.09
141 0.08
142 0.09
143 0.12
144 0.13
145 0.14
146 0.19
147 0.19
148 0.22
149 0.23
150 0.22
151 0.21
152 0.22
153 0.23
154 0.22
155 0.22
156 0.23
157 0.23
158 0.23
159 0.21
160 0.18
161 0.15
162 0.12
163 0.1
164 0.08
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.06
178 0.07
179 0.08
180 0.08
181 0.09
182 0.09
183 0.08
184 0.09
185 0.09
186 0.11
187 0.13
188 0.13
189 0.15
190 0.18
191 0.18
192 0.2
193 0.25
194 0.27
195 0.29
196 0.29
197 0.26
198 0.24
199 0.23
200 0.2
201 0.15
202 0.13
203 0.08
204 0.09
205 0.09
206 0.08
207 0.08
208 0.09
209 0.09
210 0.08
211 0.08
212 0.06
213 0.07
214 0.07
215 0.08
216 0.08
217 0.07
218 0.07
219 0.08
220 0.08
221 0.11
222 0.13
223 0.12
224 0.12
225 0.14
226 0.15
227 0.2
228 0.21
229 0.22