Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K4B9

Protein Details
Accession A0A367K4B9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-36LDHCSARSGRCPKNHKNKRQRTSSSISAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 12, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences RRCRRFGGLDHCSARSGRCPKNHKNKRQRTSSSISATSSARHNLQELNIEPSPLPPPAKLSSLKVSSISIPRGNPCNKCSTSGVYNPEYPHSSARSSLCRFHKLDIDGFLANELNLPSQRCVKKSGMTFIFAEDLSNNTCTAFSTVVTEVVDYLTVIFEWLNLRKSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.41
4 0.4
5 0.46
6 0.55
7 0.64
8 0.74
9 0.83
10 0.85
11 0.87
12 0.91
13 0.91
14 0.92
15 0.89
16 0.85
17 0.82
18 0.79
19 0.74
20 0.65
21 0.57
22 0.48
23 0.42
24 0.35
25 0.31
26 0.25
27 0.21
28 0.2
29 0.2
30 0.19
31 0.2
32 0.23
33 0.22
34 0.25
35 0.23
36 0.23
37 0.21
38 0.21
39 0.21
40 0.18
41 0.18
42 0.12
43 0.16
44 0.18
45 0.21
46 0.21
47 0.23
48 0.27
49 0.28
50 0.28
51 0.25
52 0.23
53 0.23
54 0.24
55 0.24
56 0.2
57 0.19
58 0.21
59 0.27
60 0.3
61 0.31
62 0.3
63 0.34
64 0.33
65 0.35
66 0.34
67 0.31
68 0.3
69 0.31
70 0.33
71 0.28
72 0.29
73 0.27
74 0.27
75 0.25
76 0.22
77 0.2
78 0.18
79 0.16
80 0.17
81 0.19
82 0.24
83 0.24
84 0.3
85 0.33
86 0.36
87 0.37
88 0.36
89 0.39
90 0.34
91 0.34
92 0.29
93 0.28
94 0.22
95 0.21
96 0.2
97 0.14
98 0.12
99 0.11
100 0.08
101 0.07
102 0.08
103 0.1
104 0.11
105 0.19
106 0.22
107 0.23
108 0.28
109 0.3
110 0.34
111 0.36
112 0.44
113 0.38
114 0.38
115 0.37
116 0.33
117 0.31
118 0.25
119 0.22
120 0.14
121 0.13
122 0.12
123 0.13
124 0.11
125 0.1
126 0.1
127 0.1
128 0.12
129 0.11
130 0.09
131 0.12
132 0.13
133 0.14
134 0.15
135 0.13
136 0.12
137 0.11
138 0.11
139 0.07
140 0.07
141 0.06
142 0.05
143 0.06
144 0.05
145 0.06
146 0.11
147 0.14
148 0.2