Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K5R2

Protein Details
Accession A0A367K5R2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-77NPDNKRKVSMIKQNTKPNNNKVANKKRRYHydrophilic
NLS Segment(s)
PositionSequence
74-74K
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences TVNKINGRTITIQPEPTVGAKVVSVAKSLNTRRVETNPSVNNGRKIVINPDNKRKVSMIKQNTKPNNNKVANKKRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.25
4 0.23
5 0.16
6 0.13
7 0.11
8 0.12
9 0.14
10 0.13
11 0.12
12 0.11
13 0.12
14 0.19
15 0.21
16 0.26
17 0.26
18 0.28
19 0.3
20 0.33
21 0.37
22 0.32
23 0.38
24 0.32
25 0.33
26 0.36
27 0.35
28 0.34
29 0.3
30 0.28
31 0.21
32 0.2
33 0.25
34 0.28
35 0.36
36 0.39
37 0.49
38 0.56
39 0.55
40 0.57
41 0.51
42 0.5
43 0.5
44 0.54
45 0.55
46 0.57
47 0.65
48 0.73
49 0.8
50 0.82
51 0.82
52 0.8
53 0.8
54 0.78
55 0.79
56 0.8
57 0.82