Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KK35

Protein Details
Accession A0A367KK35    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-129LAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKEBasic
NLS Segment(s)
PositionSequence
87-129PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
Subcellular Location(s) mito 18, cyto 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008233  F:peptidase activity  
GO:0003735  F:structural constituent of ribosome  
GO:0006508  P:proteolysis  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences ADATVTIRTRKFLTNRLLQRKQMVVDVIHPGLANVSKDELRSKIGKMYKADKEVVSVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.61
3 0.69
4 0.72
5 0.68
6 0.68
7 0.64
8 0.57
9 0.5
10 0.43
11 0.33
12 0.29
13 0.3
14 0.25
15 0.21
16 0.19
17 0.16
18 0.14
19 0.15
20 0.12
21 0.09
22 0.11
23 0.11
24 0.12
25 0.15
26 0.15
27 0.17
28 0.18
29 0.18
30 0.23
31 0.27
32 0.3
33 0.32
34 0.38
35 0.4
36 0.41
37 0.42
38 0.35
39 0.34
40 0.3
41 0.28
42 0.22
43 0.17
44 0.13
45 0.14
46 0.14
47 0.12
48 0.12
49 0.1
50 0.11
51 0.11
52 0.12
53 0.11
54 0.12
55 0.12
56 0.11
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.1
70 0.14
71 0.16
72 0.23
73 0.3
74 0.35
75 0.45
76 0.49
77 0.52
78 0.49
79 0.53
80 0.49
81 0.45
82 0.42
83 0.34
84 0.28
85 0.23
86 0.24
87 0.21
88 0.22
89 0.27
90 0.32
91 0.4
92 0.51
93 0.6
94 0.7
95 0.78
96 0.86
97 0.89
98 0.92
99 0.94
100 0.94
101 0.94
102 0.93
103 0.93
104 0.92
105 0.92
106 0.92
107 0.92
108 0.93
109 0.94