Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KIE4

Protein Details
Accession A0A367KIE4   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
122-148MNLAKFRHPNKKLKEIKKMKSTRCIIQHydrophilic
NLS Segment(s)
PositionSequence
130-139PNKKLKEIKK
Subcellular Location(s) nucl 13, cyto_nucl 8.5, mito 8, cyto 2, golg 2
Family & Domain DBs
Amino Acid Sequences MQSKINDKPIKFSQSLFPQCSPLLVLFQFLHFTFRAVIGDETFIDDPMDTDEDPLFMDNSKDLGESMDIDNFMNVDPSEFALPVVLGNRRYACIAPSRLLHLLGPHTIDHHYETLGEALQGMNLAKFRHPNKKLKEIKKMKSTRCIIQRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.55
4 0.49
5 0.45
6 0.44
7 0.42
8 0.35
9 0.25
10 0.21
11 0.16
12 0.18
13 0.15
14 0.15
15 0.17
16 0.15
17 0.17
18 0.14
19 0.15
20 0.12
21 0.13
22 0.12
23 0.12
24 0.13
25 0.1
26 0.11
27 0.1
28 0.13
29 0.12
30 0.12
31 0.1
32 0.09
33 0.09
34 0.09
35 0.11
36 0.08
37 0.09
38 0.08
39 0.08
40 0.09
41 0.09
42 0.07
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.05
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.08
73 0.08
74 0.1
75 0.1
76 0.11
77 0.12
78 0.12
79 0.12
80 0.16
81 0.18
82 0.18
83 0.19
84 0.22
85 0.22
86 0.22
87 0.21
88 0.16
89 0.16
90 0.15
91 0.16
92 0.12
93 0.13
94 0.13
95 0.14
96 0.15
97 0.13
98 0.12
99 0.11
100 0.12
101 0.11
102 0.1
103 0.09
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.08
111 0.09
112 0.12
113 0.19
114 0.26
115 0.36
116 0.44
117 0.52
118 0.59
119 0.69
120 0.77
121 0.79
122 0.84
123 0.84
124 0.85
125 0.87
126 0.88
127 0.86
128 0.85
129 0.81
130 0.79