Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J451

Protein Details
Accession A0A367J451    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AKSLRSATKKRTRAIKREQVFKPHydrophilic
70-98ISTSGPRSNRHARKLREKKKKGKKSAIKFBasic
NLS Segment(s)
PositionSequence
67-98KKKISTSGPRSNRHARKLREKKKKGKKSAIKF
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSATKKRTRAIKREQVFKPVEDARLERLAKAQAEAAKKESVGDYMEAETDKKAEDAMDLGEKKKISTSGPRSNRHARKLREKKKKGKKSAIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.82
4 0.78
5 0.81
6 0.77
7 0.75
8 0.68
9 0.58
10 0.54
11 0.46
12 0.42
13 0.35
14 0.33
15 0.28
16 0.33
17 0.32
18 0.26
19 0.26
20 0.26
21 0.23
22 0.22
23 0.21
24 0.18
25 0.21
26 0.22
27 0.22
28 0.19
29 0.19
30 0.19
31 0.16
32 0.13
33 0.11
34 0.1
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.11
50 0.12
51 0.13
52 0.16
53 0.16
54 0.16
55 0.17
56 0.18
57 0.16
58 0.25
59 0.34
60 0.42
61 0.51
62 0.56
63 0.62
64 0.71
65 0.75
66 0.75
67 0.75
68 0.74
69 0.76
70 0.82
71 0.86
72 0.87
73 0.89
74 0.9
75 0.92
76 0.95
77 0.94
78 0.94