Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JS56

Protein Details
Accession A0A367JS56   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-108LLAKRVKEAKDKKIERRRTSSMQKSASHydrophilic
NLS Segment(s)
PositionSequence
32-99TPKNGKKAYTKAPKIQRLVTPRTLQHKRHRQAIKRRRTEASREAESEYKQLLAKRVKEAKDKKIERRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences RLGPKRASKIRKFFNLSKEDDVRKYVIRREVTPKNGKKAYTKAPKIQRLVTPRTLQHKRHRQAIKRRRTEASREAESEYKQLLAKRVKEAKDKKIERRRTSSMQKSASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.71
4 0.68
5 0.66
6 0.61
7 0.55
8 0.51
9 0.44
10 0.42
11 0.4
12 0.39
13 0.4
14 0.38
15 0.4
16 0.46
17 0.51
18 0.55
19 0.62
20 0.61
21 0.62
22 0.63
23 0.61
24 0.58
25 0.56
26 0.57
27 0.57
28 0.58
29 0.58
30 0.63
31 0.68
32 0.66
33 0.63
34 0.59
35 0.55
36 0.54
37 0.51
38 0.46
39 0.42
40 0.48
41 0.51
42 0.52
43 0.55
44 0.6
45 0.58
46 0.65
47 0.69
48 0.69
49 0.74
50 0.77
51 0.78
52 0.76
53 0.77
54 0.74
55 0.7
56 0.69
57 0.66
58 0.63
59 0.57
60 0.5
61 0.48
62 0.45
63 0.41
64 0.35
65 0.27
66 0.22
67 0.2
68 0.2
69 0.24
70 0.29
71 0.31
72 0.38
73 0.46
74 0.49
75 0.58
76 0.64
77 0.66
78 0.7
79 0.75
80 0.77
81 0.8
82 0.86
83 0.84
84 0.85
85 0.83
86 0.81
87 0.84
88 0.83
89 0.82