Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IJV1

Protein Details
Accession A0A367IJV1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-84LPKHPAYKKVENKKNIKTLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015063  USP8_dimer  
Gene Ontology GO:0016579  P:protein deubiquitination  
Pfam View protein in Pfam  
PF08969  USP8_dimer  
Amino Acid Sequences MSIPRSTEELERLSNISVDHNIPVKLYFRSAELILKQARVYKLENDLEHAYLLYMKYTNLGLSELPKHPAYKKVENKKNIKTLNKNCLEALEALESMKPQLNKIYKSYKEQIQRKSPIKSPPPEDTLPEKEQTEKTSIEHIDQYSPSSPPLEALGDHLKEWNLQEALEGVQGVGYRNTTATDHSETSYSNHEKTDYPSLNKHNQSDQYNYQASYRTHQLISPPKLPPKIPHPQQPHYPTIPPKIPFAENRPELPPKIKISSGPTVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.19
5 0.18
6 0.2
7 0.21
8 0.21
9 0.2
10 0.21
11 0.21
12 0.2
13 0.21
14 0.18
15 0.17
16 0.19
17 0.2
18 0.23
19 0.22
20 0.27
21 0.27
22 0.27
23 0.27
24 0.3
25 0.31
26 0.29
27 0.3
28 0.28
29 0.34
30 0.38
31 0.37
32 0.36
33 0.36
34 0.33
35 0.31
36 0.26
37 0.18
38 0.14
39 0.14
40 0.1
41 0.09
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.09
48 0.09
49 0.12
50 0.17
51 0.17
52 0.2
53 0.21
54 0.23
55 0.24
56 0.32
57 0.36
58 0.41
59 0.49
60 0.57
61 0.65
62 0.72
63 0.78
64 0.79
65 0.8
66 0.78
67 0.77
68 0.77
69 0.77
70 0.78
71 0.73
72 0.66
73 0.57
74 0.5
75 0.43
76 0.32
77 0.25
78 0.16
79 0.12
80 0.11
81 0.11
82 0.1
83 0.09
84 0.11
85 0.1
86 0.09
87 0.16
88 0.21
89 0.23
90 0.28
91 0.36
92 0.36
93 0.42
94 0.46
95 0.46
96 0.51
97 0.56
98 0.59
99 0.59
100 0.65
101 0.64
102 0.63
103 0.62
104 0.61
105 0.62
106 0.59
107 0.55
108 0.51
109 0.51
110 0.47
111 0.45
112 0.41
113 0.4
114 0.37
115 0.33
116 0.29
117 0.26
118 0.27
119 0.25
120 0.23
121 0.17
122 0.16
123 0.19
124 0.19
125 0.18
126 0.19
127 0.18
128 0.16
129 0.16
130 0.17
131 0.13
132 0.13
133 0.12
134 0.11
135 0.1
136 0.09
137 0.1
138 0.09
139 0.07
140 0.1
141 0.14
142 0.14
143 0.14
144 0.14
145 0.13
146 0.14
147 0.14
148 0.14
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.09
155 0.09
156 0.05
157 0.05
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.08
165 0.08
166 0.09
167 0.12
168 0.16
169 0.16
170 0.17
171 0.17
172 0.17
173 0.18
174 0.24
175 0.23
176 0.21
177 0.2
178 0.21
179 0.22
180 0.26
181 0.34
182 0.31
183 0.32
184 0.37
185 0.43
186 0.5
187 0.53
188 0.52
189 0.49
190 0.51
191 0.51
192 0.52
193 0.49
194 0.47
195 0.45
196 0.42
197 0.37
198 0.36
199 0.34
200 0.31
201 0.33
202 0.29
203 0.27
204 0.28
205 0.34
206 0.39
207 0.44
208 0.46
209 0.46
210 0.5
211 0.53
212 0.54
213 0.52
214 0.51
215 0.55
216 0.56
217 0.61
218 0.63
219 0.65
220 0.73
221 0.74
222 0.72
223 0.66
224 0.66
225 0.62
226 0.62
227 0.62
228 0.54
229 0.52
230 0.5
231 0.5
232 0.49
233 0.49
234 0.51
235 0.48
236 0.5
237 0.51
238 0.52
239 0.51
240 0.5
241 0.5
242 0.46
243 0.47
244 0.46
245 0.44
246 0.46