Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KWR7

Protein Details
Accession A0A367KWR7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-147ITEKHEKKEKELKKGKKNKNKEKEKKQNKSSQKLDKDYEBasic
NLS Segment(s)
PositionSequence
112-137KHEKKEKELKKGKKNKNKEKEKKQNK
Subcellular Location(s) E.R. 7, nucl 6, cyto 5, golg 4, vacu 3, cyto_mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR018247  EF_Hand_1_Ca_BS  
IPR002048  EF_hand_dom  
IPR040250  Nucleobindin  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0005509  F:calcium ion binding  
Pfam View protein in Pfam  
PF13499  EF-hand_7  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MLKYITLAFITLLPVLCELQHAFEQKHMKEAHQMEVADEIAFFKIHDLNKDGHWDESELLSMYGTERNVDPQAEHIQNIIKTIHNTMDLDKDGLISQDEYITNAALPPITEKHEKKEKELKKGKKNKNKEKEKKQNKSSQKLDKDYEFVVPAKFRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.11
5 0.1
6 0.12
7 0.15
8 0.18
9 0.18
10 0.24
11 0.31
12 0.29
13 0.36
14 0.34
15 0.31
16 0.37
17 0.39
18 0.38
19 0.35
20 0.35
21 0.28
22 0.28
23 0.28
24 0.19
25 0.16
26 0.11
27 0.08
28 0.08
29 0.07
30 0.06
31 0.1
32 0.11
33 0.14
34 0.15
35 0.16
36 0.18
37 0.23
38 0.23
39 0.2
40 0.19
41 0.18
42 0.16
43 0.15
44 0.15
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.08
51 0.07
52 0.07
53 0.07
54 0.09
55 0.1
56 0.1
57 0.1
58 0.11
59 0.16
60 0.16
61 0.16
62 0.15
63 0.16
64 0.16
65 0.17
66 0.15
67 0.1
68 0.1
69 0.11
70 0.12
71 0.11
72 0.11
73 0.11
74 0.13
75 0.13
76 0.12
77 0.11
78 0.11
79 0.09
80 0.09
81 0.09
82 0.06
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.05
93 0.05
94 0.07
95 0.08
96 0.12
97 0.2
98 0.21
99 0.29
100 0.38
101 0.39
102 0.45
103 0.54
104 0.57
105 0.6
106 0.69
107 0.72
108 0.74
109 0.84
110 0.87
111 0.87
112 0.92
113 0.92
114 0.93
115 0.94
116 0.94
117 0.95
118 0.95
119 0.96
120 0.95
121 0.94
122 0.93
123 0.92
124 0.92
125 0.9
126 0.89
127 0.88
128 0.84
129 0.8
130 0.73
131 0.66
132 0.57
133 0.51
134 0.43
135 0.35
136 0.32