Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KN66

Protein Details
Accession A0A367KN66    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20HHKRPFTQKKNPLKNQGVMNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR025755  Ribos_L4_C_dom  
Pfam View protein in Pfam  
PF14374  Ribos_L4_asso_C  
Amino Acid Sequences HHKRPFTQKKNPLKNQGVMNRLNPYAQVLRRAEIIKAEKAASGKVVKVQKKKTVSTAANKKFLETLHSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.71
5 0.63
6 0.57
7 0.5
8 0.44
9 0.38
10 0.29
11 0.26
12 0.25
13 0.23
14 0.26
15 0.23
16 0.23
17 0.26
18 0.27
19 0.23
20 0.23
21 0.24
22 0.18
23 0.19
24 0.18
25 0.17
26 0.16
27 0.16
28 0.14
29 0.13
30 0.12
31 0.17
32 0.24
33 0.3
34 0.38
35 0.44
36 0.5
37 0.55
38 0.57
39 0.58
40 0.6
41 0.61
42 0.63
43 0.67
44 0.67
45 0.69
46 0.66
47 0.61
48 0.54
49 0.47