Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J6Z3

Protein Details
Accession A0A367J6Z3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35EEEKEFKKKPTMKGVDKKAABasic
NLS Segment(s)
PositionSequence
21-37FKKKPTMKGVDKKAAQK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010422  Ccdc124/Oxs1  
Pfam View protein in Pfam  
PF06244  Ccdc124  
Amino Acid Sequences AAAAAKKAENAKLLAEEEKEFKKKPTMKGVDKKAAQKSAKVDAAGHARRVIPEFSATGIDDALDLLSLDSGSVKAKDIEKHPERRFKAAFAAFEERELPRFKAENPGLRLSQLKELIYKAFQKSPENPFNQANVIAYNATQDEAQAMKANKNKAIEDRLRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.25
5 0.31
6 0.33
7 0.32
8 0.33
9 0.4
10 0.45
11 0.5
12 0.57
13 0.6
14 0.66
15 0.74
16 0.8
17 0.8
18 0.78
19 0.78
20 0.74
21 0.73
22 0.64
23 0.59
24 0.54
25 0.52
26 0.49
27 0.42
28 0.36
29 0.31
30 0.39
31 0.36
32 0.33
33 0.27
34 0.25
35 0.25
36 0.27
37 0.23
38 0.15
39 0.14
40 0.13
41 0.12
42 0.13
43 0.12
44 0.1
45 0.09
46 0.08
47 0.06
48 0.06
49 0.05
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.07
62 0.1
63 0.13
64 0.16
65 0.25
66 0.3
67 0.4
68 0.44
69 0.52
70 0.51
71 0.55
72 0.53
73 0.45
74 0.45
75 0.38
76 0.34
77 0.3
78 0.33
79 0.27
80 0.26
81 0.26
82 0.2
83 0.2
84 0.21
85 0.17
86 0.15
87 0.16
88 0.16
89 0.24
90 0.28
91 0.33
92 0.35
93 0.38
94 0.36
95 0.36
96 0.37
97 0.29
98 0.31
99 0.26
100 0.23
101 0.21
102 0.22
103 0.22
104 0.23
105 0.26
106 0.24
107 0.25
108 0.28
109 0.31
110 0.37
111 0.44
112 0.49
113 0.48
114 0.49
115 0.47
116 0.46
117 0.43
118 0.37
119 0.29
120 0.21
121 0.19
122 0.15
123 0.12
124 0.12
125 0.1
126 0.1
127 0.09
128 0.08
129 0.09
130 0.09
131 0.1
132 0.14
133 0.16
134 0.21
135 0.27
136 0.31
137 0.34
138 0.37
139 0.39
140 0.41
141 0.49
142 0.51