Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JE37

Protein Details
Accession A0A367JE37    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-78LRKPSPPPTKDTKKRARDNKGKKRAVMBasic
NLS Segment(s)
PositionSequence
54-75KPSPPPTKDTKKRARDNKGKKR
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
Amino Acid Sequences DDVHRSYNRITCGTEEHKTHVLDLVDDDPQVTICDVVESLTKSFEGVIHIVLRKPSPPPTKDTKKRARDNKGKKRAVMAVEEEANTTTSGYSQKPPPKGTTFAHYTKEDARKKIWVSEETFFLHSKVKELGFSEAGKDIVLPINEKYLNDGLLKLLKKLRDIFSVFVETNPSRISQLVSVGFLVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.39
4 0.42
5 0.41
6 0.39
7 0.35
8 0.3
9 0.24
10 0.24
11 0.21
12 0.17
13 0.16
14 0.15
15 0.11
16 0.11
17 0.11
18 0.08
19 0.06
20 0.05
21 0.06
22 0.06
23 0.07
24 0.09
25 0.1
26 0.1
27 0.11
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.1
35 0.13
36 0.14
37 0.15
38 0.16
39 0.16
40 0.15
41 0.18
42 0.26
43 0.31
44 0.32
45 0.36
46 0.45
47 0.55
48 0.63
49 0.71
50 0.72
51 0.74
52 0.82
53 0.86
54 0.87
55 0.87
56 0.89
57 0.9
58 0.9
59 0.85
60 0.76
61 0.7
62 0.64
63 0.56
64 0.48
65 0.39
66 0.3
67 0.27
68 0.25
69 0.21
70 0.16
71 0.14
72 0.11
73 0.08
74 0.06
75 0.06
76 0.08
77 0.09
78 0.11
79 0.17
80 0.22
81 0.26
82 0.29
83 0.32
84 0.33
85 0.37
86 0.36
87 0.34
88 0.35
89 0.34
90 0.36
91 0.32
92 0.31
93 0.33
94 0.41
95 0.41
96 0.38
97 0.36
98 0.37
99 0.38
100 0.41
101 0.39
102 0.34
103 0.34
104 0.33
105 0.33
106 0.3
107 0.31
108 0.26
109 0.22
110 0.22
111 0.18
112 0.18
113 0.19
114 0.17
115 0.17
116 0.18
117 0.2
118 0.19
119 0.19
120 0.18
121 0.17
122 0.16
123 0.14
124 0.13
125 0.1
126 0.11
127 0.11
128 0.11
129 0.11
130 0.16
131 0.17
132 0.17
133 0.2
134 0.18
135 0.19
136 0.18
137 0.18
138 0.15
139 0.21
140 0.21
141 0.21
142 0.24
143 0.24
144 0.29
145 0.34
146 0.36
147 0.37
148 0.39
149 0.38
150 0.38
151 0.41
152 0.37
153 0.31
154 0.34
155 0.27
156 0.26
157 0.25
158 0.22
159 0.18
160 0.18
161 0.2
162 0.15
163 0.2
164 0.2
165 0.2