Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J3S4

Protein Details
Accession A0A367J3S4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-47LTATCRNSDRKERKKGVKRGPYKKRQIKENVVVHydrophilic
NLS Segment(s)
PositionSequence
24-40RKERKKGVKRGPYKKRQ
Subcellular Location(s) nucl 12, mito 7.5, cyto_mito 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences CDDGRPCGRCIKLGLTATCRNSDRKERKKGVKRGPYKKRQIKENVVVYPQLAQEPWMVPTQMQWTDLIGCPANSFADETLHWEAEKIWSMPLEQHYELDLFQEPHVWYPVSPCIPLYPTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.48
4 0.47
5 0.49
6 0.46
7 0.43
8 0.44
9 0.51
10 0.55
11 0.58
12 0.66
13 0.71
14 0.79
15 0.85
16 0.9
17 0.89
18 0.89
19 0.89
20 0.89
21 0.9
22 0.9
23 0.91
24 0.89
25 0.84
26 0.83
27 0.82
28 0.8
29 0.78
30 0.74
31 0.66
32 0.58
33 0.53
34 0.43
35 0.36
36 0.27
37 0.19
38 0.11
39 0.09
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.08
46 0.1
47 0.12
48 0.12
49 0.12
50 0.1
51 0.1
52 0.12
53 0.12
54 0.12
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.07
64 0.07
65 0.12
66 0.13
67 0.14
68 0.13
69 0.13
70 0.13
71 0.14
72 0.17
73 0.12
74 0.11
75 0.11
76 0.12
77 0.15
78 0.18
79 0.21
80 0.19
81 0.19
82 0.2
83 0.2
84 0.19
85 0.18
86 0.18
87 0.13
88 0.13
89 0.17
90 0.16
91 0.18
92 0.2
93 0.19
94 0.16
95 0.19
96 0.26
97 0.24
98 0.24
99 0.23
100 0.24