Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K4R4

Protein Details
Accession A0A367K4R4    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-174DQDLQIKKYRKKLRELDQAVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, mito_nucl 9.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006955  Uso1_p115_C  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF04871  Uso1_p115_C  
Amino Acid Sequences DAANPLPSLLLDSIFVDFFKSTYENVQKTLKKKPADFNKPESASIPSSPVVADEVVQSYKTKIDEQANLVKSLEQKVTELEASVQLLTVDNGQLKSDLVSYTKENASLKEKASELEAKDQSSKIKELEEKLVEQQAKFEELEKEQEDVLVLMGDQDLQIKKYRKKLRELDQAVSDSEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.1
5 0.09
6 0.11
7 0.11
8 0.11
9 0.19
10 0.28
11 0.27
12 0.31
13 0.39
14 0.43
15 0.46
16 0.55
17 0.54
18 0.53
19 0.58
20 0.64
21 0.67
22 0.72
23 0.74
24 0.72
25 0.74
26 0.69
27 0.64
28 0.55
29 0.48
30 0.4
31 0.34
32 0.29
33 0.2
34 0.18
35 0.17
36 0.15
37 0.12
38 0.1
39 0.09
40 0.07
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.11
47 0.12
48 0.13
49 0.16
50 0.2
51 0.22
52 0.26
53 0.33
54 0.33
55 0.32
56 0.31
57 0.27
58 0.24
59 0.24
60 0.21
61 0.13
62 0.12
63 0.12
64 0.14
65 0.12
66 0.11
67 0.09
68 0.08
69 0.08
70 0.07
71 0.07
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.06
85 0.07
86 0.08
87 0.09
88 0.12
89 0.12
90 0.15
91 0.14
92 0.16
93 0.2
94 0.21
95 0.21
96 0.2
97 0.2
98 0.18
99 0.21
100 0.23
101 0.19
102 0.25
103 0.25
104 0.24
105 0.26
106 0.26
107 0.27
108 0.25
109 0.25
110 0.18
111 0.21
112 0.24
113 0.25
114 0.31
115 0.3
116 0.29
117 0.3
118 0.35
119 0.32
120 0.28
121 0.27
122 0.22
123 0.22
124 0.2
125 0.2
126 0.18
127 0.18
128 0.23
129 0.22
130 0.22
131 0.2
132 0.2
133 0.17
134 0.14
135 0.13
136 0.07
137 0.06
138 0.05
139 0.05
140 0.05
141 0.04
142 0.08
143 0.09
144 0.11
145 0.19
146 0.27
147 0.33
148 0.44
149 0.54
150 0.57
151 0.66
152 0.74
153 0.77
154 0.81
155 0.8
156 0.76
157 0.72
158 0.67
159 0.58