Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J608

Protein Details
Accession A0A367J608    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-78ESTHTKKKVVIVKKKRKDTTQQVHydrophilic
NLS Segment(s)
PositionSequence
68-71KKKR
Subcellular Location(s) extr 16, mito 6, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031459  Coa2  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF17051  COA2  
Amino Acid Sequences MWTKARHLNHSQKQRITNNLFVAVAVGAVLTVAGPTLLPCPAYDQNDRSAFLEQEESTHTKKKVVIVKKKRKDTTQQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.7
4 0.66
5 0.58
6 0.51
7 0.45
8 0.36
9 0.31
10 0.21
11 0.14
12 0.08
13 0.05
14 0.03
15 0.03
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.04
25 0.04
26 0.04
27 0.09
28 0.13
29 0.17
30 0.19
31 0.2
32 0.26
33 0.28
34 0.29
35 0.25
36 0.24
37 0.21
38 0.19
39 0.2
40 0.14
41 0.14
42 0.16
43 0.19
44 0.2
45 0.26
46 0.25
47 0.25
48 0.28
49 0.34
50 0.39
51 0.46
52 0.55
53 0.6
54 0.71
55 0.78
56 0.86
57 0.87
58 0.86