Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KK44

Protein Details
Accession A0A367KK44    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-45SKPEEPKKEEAPKKEEPKKEEAPKKQEPKKEEBasic
NLS Segment(s)
PositionSequence
6-53KKEEPKEESKPEEPKKEEAPKKEEPKKEEAPKKQEPKKEESKPAAEKA
Subcellular Location(s) cyto_nucl 14.5, cyto 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001078  2-oxoacid_DH_actylTfrase  
IPR023213  CAT-like_dom_sf  
IPR006255  SucB  
Gene Ontology GO:0045252  C:oxoglutarate dehydrogenase complex  
GO:0004149  F:dihydrolipoyllysine-residue succinyltransferase activity  
GO:0006099  P:tricarboxylic acid cycle  
Pfam View protein in Pfam  
PF00198  2-oxoacid_dh  
Amino Acid Sequences AAPAAKKEEPKEESKPEEPKKEEAPKKEEPKKEEAPKKQEPKKEESKPAAEKAYGNRNETRVKMNRMRLRIAERLKQSQDTAASLTTFNEIDMTNLMNLRSEYKDAIVKKHGVKFGFMSAFAKAASEALTEIPAVNASIDGNEIVYHDFVDMSIAVATPKGLVTPVLRNVEDMGLIDIEKNIAELGKKARDNKITIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAILGMHAIKERPIAVNGKVEIRPMMYVALTYDHRLVDGREAVTFLVRIKELIEDPRRFLLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.68
4 0.73
5 0.7
6 0.68
7 0.69
8 0.73
9 0.73
10 0.71
11 0.7
12 0.7
13 0.77
14 0.8
15 0.79
16 0.74
17 0.74
18 0.76
19 0.79
20 0.79
21 0.78
22 0.78
23 0.81
24 0.85
25 0.85
26 0.82
27 0.78
28 0.77
29 0.77
30 0.77
31 0.77
32 0.74
33 0.75
34 0.73
35 0.72
36 0.67
37 0.58
38 0.52
39 0.49
40 0.51
41 0.47
42 0.45
43 0.43
44 0.44
45 0.47
46 0.45
47 0.48
48 0.45
49 0.49
50 0.53
51 0.59
52 0.62
53 0.62
54 0.64
55 0.6
56 0.59
57 0.59
58 0.57
59 0.55
60 0.53
61 0.56
62 0.54
63 0.51
64 0.46
65 0.41
66 0.36
67 0.3
68 0.26
69 0.19
70 0.17
71 0.15
72 0.14
73 0.12
74 0.1
75 0.09
76 0.09
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.09
86 0.11
87 0.12
88 0.12
89 0.12
90 0.13
91 0.18
92 0.18
93 0.22
94 0.23
95 0.27
96 0.3
97 0.35
98 0.37
99 0.32
100 0.33
101 0.3
102 0.3
103 0.26
104 0.22
105 0.17
106 0.14
107 0.14
108 0.12
109 0.11
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.03
148 0.03
149 0.05
150 0.06
151 0.1
152 0.15
153 0.17
154 0.18
155 0.18
156 0.18
157 0.17
158 0.16
159 0.13
160 0.08
161 0.06
162 0.06
163 0.06
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.07
172 0.11
173 0.17
174 0.2
175 0.24
176 0.31
177 0.35
178 0.37
179 0.39
180 0.41
181 0.37
182 0.34
183 0.31
184 0.26
185 0.21
186 0.19
187 0.15
188 0.08
189 0.06
190 0.06
191 0.05
192 0.05
193 0.04
194 0.04
195 0.04
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.06
207 0.07
208 0.06
209 0.06
210 0.07
211 0.07
212 0.08
213 0.08
214 0.07
215 0.06
216 0.08
217 0.08
218 0.1
219 0.11
220 0.11
221 0.12
222 0.13
223 0.14
224 0.14
225 0.18
226 0.18
227 0.19
228 0.25
229 0.26
230 0.29
231 0.29
232 0.28
233 0.26
234 0.23
235 0.21
236 0.16
237 0.16
238 0.11
239 0.1
240 0.1
241 0.13
242 0.13
243 0.15
244 0.16
245 0.15
246 0.15
247 0.16
248 0.16
249 0.18
250 0.21
251 0.2
252 0.19
253 0.19
254 0.19
255 0.19
256 0.19
257 0.15
258 0.14
259 0.14
260 0.13
261 0.13
262 0.17
263 0.19
264 0.28
265 0.35
266 0.35
267 0.38
268 0.42