Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KIQ0

Protein Details
Accession A0A367KIQ0   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-56LIYFDHKRRNDPQYKKQKKLERKKAAKLEKEFKBasic
NLS Segment(s)
PositionSequence
32-53RNDPQYKKQKKLERKKAAKLEK
Subcellular Location(s) cyto 8, extr 6, cyto_nucl 6, E.R. 5, mito 3, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MALKPSTIALISTAVAASFGIGYLIYFDHKRRNDPQYKKQKKLERKKAAKLEKEFKQKEVQSVETLIKYVIDKVNAETFPTTAEAVEAYFVDQVALGEECIKQGQEEASVEHFYKALKIYPAPLELIMIYQKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.07
13 0.09
14 0.12
15 0.2
16 0.23
17 0.29
18 0.36
19 0.46
20 0.54
21 0.61
22 0.7
23 0.72
24 0.8
25 0.83
26 0.85
27 0.84
28 0.85
29 0.87
30 0.88
31 0.87
32 0.86
33 0.87
34 0.89
35 0.88
36 0.85
37 0.82
38 0.79
39 0.76
40 0.77
41 0.69
42 0.61
43 0.6
44 0.53
45 0.5
46 0.45
47 0.39
48 0.29
49 0.3
50 0.28
51 0.21
52 0.19
53 0.14
54 0.11
55 0.09
56 0.1
57 0.09
58 0.09
59 0.09
60 0.1
61 0.15
62 0.14
63 0.15
64 0.13
65 0.12
66 0.12
67 0.13
68 0.11
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.07
88 0.08
89 0.06
90 0.07
91 0.08
92 0.1
93 0.11
94 0.12
95 0.15
96 0.17
97 0.18
98 0.17
99 0.16
100 0.14
101 0.16
102 0.15
103 0.16
104 0.17
105 0.18
106 0.21
107 0.25
108 0.26
109 0.25
110 0.24
111 0.21
112 0.18
113 0.19