Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J2H3

Protein Details
Accession A0A367J2H3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-45ADEQHRRVRSRAKTRRSRSRTTSLAHydrophilic
NLS Segment(s)
PositionSequence
27-38RVRSRAKTRRSR
Subcellular Location(s) extr 21, plas 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009009  RlpA-like_DPBB  
IPR036908  RlpA-like_sf  
Pfam View protein in Pfam  
PF03330  DPBB_1  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MRFLFLMFVILIITVITTTLADEQHRRVRSRAKTRRSRSRTTSLATKTTNTRPTSRANTTSKAAATTTKAIAPTSAPVSNNGATYLGDGTWYDIGLGSCGWTNSDSEFVAALNAPQMQNGENPNKNSNCGRMIRVINTANNKAVNVKIVDTCPPCASGSVDLSPSAFSQIADLSTGRIKIKWSWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.08
8 0.11
9 0.15
10 0.21
11 0.29
12 0.34
13 0.36
14 0.4
15 0.48
16 0.56
17 0.64
18 0.68
19 0.71
20 0.76
21 0.84
22 0.9
23 0.88
24 0.87
25 0.83
26 0.81
27 0.76
28 0.7
29 0.69
30 0.62
31 0.61
32 0.53
33 0.49
34 0.46
35 0.47
36 0.5
37 0.44
38 0.43
39 0.4
40 0.46
41 0.5
42 0.5
43 0.51
44 0.47
45 0.48
46 0.46
47 0.45
48 0.38
49 0.32
50 0.27
51 0.21
52 0.19
53 0.18
54 0.17
55 0.16
56 0.16
57 0.14
58 0.14
59 0.13
60 0.12
61 0.12
62 0.13
63 0.12
64 0.13
65 0.16
66 0.17
67 0.16
68 0.15
69 0.12
70 0.1
71 0.11
72 0.09
73 0.06
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.1
106 0.14
107 0.2
108 0.23
109 0.26
110 0.32
111 0.32
112 0.35
113 0.34
114 0.33
115 0.32
116 0.31
117 0.3
118 0.3
119 0.32
120 0.31
121 0.35
122 0.34
123 0.34
124 0.37
125 0.37
126 0.33
127 0.31
128 0.29
129 0.26
130 0.23
131 0.22
132 0.17
133 0.17
134 0.17
135 0.18
136 0.24
137 0.24
138 0.26
139 0.24
140 0.24
141 0.23
142 0.22
143 0.22
144 0.19
145 0.21
146 0.2
147 0.2
148 0.19
149 0.19
150 0.18
151 0.16
152 0.16
153 0.12
154 0.1
155 0.11
156 0.11
157 0.12
158 0.12
159 0.12
160 0.12
161 0.14
162 0.17
163 0.17
164 0.17
165 0.2