Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KV09

Protein Details
Accession A0A367KV09   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-91SATSPKKKRREMPKEALTPRHydrophilic
NLS Segment(s)
PositionSequence
77-82KKKRRE
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSELSLSEMLEQEKLAKIKKVPIESRYKTMPVLPERKRGDISEAARDAIDKVKRTMVDGKPTMKRVGAFLVSATSPKKKRREMPKEALTPRTSLSRILGSNIFEDYAKESPDNEDEFSLGDLIEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.25
5 0.32
6 0.38
7 0.45
8 0.47
9 0.51
10 0.59
11 0.59
12 0.61
13 0.58
14 0.53
15 0.45
16 0.42
17 0.42
18 0.4
19 0.46
20 0.45
21 0.5
22 0.52
23 0.54
24 0.53
25 0.46
26 0.43
27 0.41
28 0.39
29 0.37
30 0.34
31 0.31
32 0.29
33 0.28
34 0.24
35 0.22
36 0.22
37 0.17
38 0.17
39 0.2
40 0.2
41 0.23
42 0.3
43 0.28
44 0.32
45 0.33
46 0.37
47 0.38
48 0.4
49 0.38
50 0.3
51 0.27
52 0.21
53 0.2
54 0.16
55 0.12
56 0.1
57 0.1
58 0.1
59 0.11
60 0.11
61 0.15
62 0.2
63 0.28
64 0.36
65 0.42
66 0.51
67 0.61
68 0.7
69 0.73
70 0.78
71 0.79
72 0.81
73 0.78
74 0.75
75 0.65
76 0.56
77 0.47
78 0.41
79 0.33
80 0.25
81 0.23
82 0.22
83 0.21
84 0.23
85 0.24
86 0.2
87 0.21
88 0.2
89 0.18
90 0.13
91 0.14
92 0.15
93 0.15
94 0.15
95 0.14
96 0.15
97 0.18
98 0.22
99 0.23
100 0.21
101 0.19
102 0.18
103 0.19
104 0.18
105 0.15
106 0.11