Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K065

Protein Details
Accession A0A367K065    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
65-87FLQYRECKKKWMEERRRLRRAGEBasic
NLS Segment(s)
PositionSequence
80-81RR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPLSKPSAPPPKPDFGDPSTPQDFNDKFRDKAITKYMNPCALEEKQSMKCLDQNNYDKTKCDFYFLQYRECKKKWMEERRRLRRAGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.54
4 0.48
5 0.49
6 0.45
7 0.42
8 0.39
9 0.41
10 0.38
11 0.33
12 0.4
13 0.37
14 0.34
15 0.35
16 0.41
17 0.35
18 0.39
19 0.42
20 0.4
21 0.39
22 0.44
23 0.46
24 0.44
25 0.43
26 0.38
27 0.35
28 0.29
29 0.29
30 0.24
31 0.24
32 0.22
33 0.25
34 0.24
35 0.21
36 0.24
37 0.25
38 0.27
39 0.31
40 0.35
41 0.38
42 0.43
43 0.43
44 0.42
45 0.4
46 0.44
47 0.35
48 0.34
49 0.29
50 0.28
51 0.38
52 0.37
53 0.43
54 0.43
55 0.5
56 0.54
57 0.55
58 0.57
59 0.51
60 0.59
61 0.61
62 0.66
63 0.7
64 0.72
65 0.82
66 0.86
67 0.9
68 0.83