Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J1X8

Protein Details
Accession A0A367J1X8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-73LRERIRVKKIEKKTEKKTEKKTEKKTEKKTEKKTEKKTEKKIEKKTEKIRYSTKBasic
NLS Segment(s)
PositionSequence
21-67RERIRVKKIEKKTEKKTEKKTEKKTEKKTEKKTEKKTEKKIEKKTEK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences LKFETIGGRTTAFSPSRQILRERIRVKKIEKKTEKKTEKKTEKKTEKKTEKKTEKKTEKKIEKKTEKIRYSTKYNLRQIQCNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.3
5 0.32
6 0.35
7 0.42
8 0.5
9 0.53
10 0.57
11 0.59
12 0.63
13 0.67
14 0.68
15 0.69
16 0.71
17 0.74
18 0.75
19 0.79
20 0.83
21 0.86
22 0.85
23 0.86
24 0.86
25 0.87
26 0.87
27 0.88
28 0.88
29 0.89
30 0.9
31 0.9
32 0.9
33 0.9
34 0.9
35 0.9
36 0.9
37 0.9
38 0.9
39 0.9
40 0.9
41 0.9
42 0.9
43 0.9
44 0.9
45 0.9
46 0.9
47 0.9
48 0.91
49 0.9
50 0.9
51 0.9
52 0.89
53 0.84
54 0.81
55 0.79
56 0.74
57 0.72
58 0.72
59 0.72
60 0.71
61 0.74
62 0.77
63 0.72