Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KUV9

Protein Details
Accession A0A367KUV9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSTPQFKSKRQQKIWERERQEVESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004574  Alkb  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
Amino Acid Sequences MSTPQFKSKRQQKIWERERQEVESKKKNASSYVNQAPFRYCERNFKSRVPPPDYSQVIDLGDLPGKHNPEILNELVPVKLTQDLSQLSSLFGDRPCEDAYLLKNVPGLIVIPNAFTPQAQIHLIKQCLSLYPRPPNTSNLDTHYNMPDGGLWPLYERETSGKLTARDPEFYIPKKAPVEESESDSEPETVVVCRRELTACSDDFKPVIDEPKPDPAPASTVPLLPPSELVRKLRWVTLGYQYHWPTKTYHLDRRYPFPEDVAEFTKAVVYAIENVGYDDGKEAWKNEYKGDDFVAEAGVINYYQYRDTLMGHVDRSELNMEAPLVSLSLGHSCIYLIGGATRETVPTPLLLRSGDIIVMTGPCRKAFHGVPLIIENSLPEYLSNEEDPDYKLFGDFMSTSRINLNIRQVYPPGEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.86
4 0.84
5 0.81
6 0.76
7 0.75
8 0.73
9 0.72
10 0.72
11 0.7
12 0.68
13 0.66
14 0.63
15 0.61
16 0.6
17 0.58
18 0.58
19 0.63
20 0.64
21 0.61
22 0.6
23 0.56
24 0.51
25 0.5
26 0.48
27 0.41
28 0.45
29 0.5
30 0.58
31 0.6
32 0.65
33 0.68
34 0.69
35 0.75
36 0.72
37 0.69
38 0.66
39 0.7
40 0.64
41 0.55
42 0.49
43 0.41
44 0.34
45 0.29
46 0.24
47 0.16
48 0.16
49 0.15
50 0.15
51 0.17
52 0.19
53 0.19
54 0.21
55 0.2
56 0.21
57 0.25
58 0.25
59 0.22
60 0.21
61 0.22
62 0.19
63 0.19
64 0.15
65 0.11
66 0.13
67 0.13
68 0.13
69 0.16
70 0.18
71 0.19
72 0.21
73 0.2
74 0.17
75 0.17
76 0.16
77 0.14
78 0.14
79 0.16
80 0.14
81 0.17
82 0.18
83 0.18
84 0.17
85 0.18
86 0.19
87 0.23
88 0.23
89 0.2
90 0.2
91 0.19
92 0.19
93 0.16
94 0.14
95 0.08
96 0.1
97 0.09
98 0.09
99 0.09
100 0.1
101 0.1
102 0.09
103 0.1
104 0.08
105 0.11
106 0.12
107 0.13
108 0.16
109 0.22
110 0.23
111 0.22
112 0.23
113 0.21
114 0.22
115 0.25
116 0.27
117 0.28
118 0.36
119 0.4
120 0.44
121 0.45
122 0.46
123 0.48
124 0.47
125 0.42
126 0.38
127 0.38
128 0.35
129 0.35
130 0.33
131 0.27
132 0.23
133 0.2
134 0.16
135 0.12
136 0.11
137 0.09
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.12
146 0.14
147 0.16
148 0.18
149 0.19
150 0.21
151 0.26
152 0.25
153 0.24
154 0.25
155 0.26
156 0.28
157 0.28
158 0.31
159 0.26
160 0.29
161 0.29
162 0.28
163 0.26
164 0.22
165 0.28
166 0.24
167 0.28
168 0.25
169 0.25
170 0.25
171 0.23
172 0.21
173 0.14
174 0.12
175 0.09
176 0.07
177 0.09
178 0.09
179 0.09
180 0.09
181 0.1
182 0.11
183 0.11
184 0.16
185 0.16
186 0.16
187 0.19
188 0.19
189 0.18
190 0.18
191 0.17
192 0.13
193 0.11
194 0.14
195 0.13
196 0.15
197 0.16
198 0.24
199 0.24
200 0.23
201 0.22
202 0.19
203 0.22
204 0.19
205 0.22
206 0.14
207 0.15
208 0.15
209 0.16
210 0.16
211 0.12
212 0.13
213 0.11
214 0.15
215 0.17
216 0.19
217 0.19
218 0.23
219 0.24
220 0.25
221 0.25
222 0.22
223 0.22
224 0.29
225 0.3
226 0.28
227 0.33
228 0.34
229 0.36
230 0.35
231 0.34
232 0.26
233 0.29
234 0.37
235 0.37
236 0.44
237 0.46
238 0.52
239 0.54
240 0.59
241 0.57
242 0.52
243 0.45
244 0.38
245 0.34
246 0.28
247 0.29
248 0.25
249 0.23
250 0.18
251 0.18
252 0.17
253 0.14
254 0.13
255 0.09
256 0.06
257 0.07
258 0.07
259 0.08
260 0.07
261 0.07
262 0.08
263 0.08
264 0.07
265 0.06
266 0.07
267 0.08
268 0.08
269 0.09
270 0.14
271 0.2
272 0.21
273 0.22
274 0.27
275 0.27
276 0.27
277 0.27
278 0.23
279 0.18
280 0.17
281 0.15
282 0.09
283 0.08
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.06
290 0.06
291 0.06
292 0.08
293 0.08
294 0.1
295 0.12
296 0.15
297 0.16
298 0.17
299 0.17
300 0.17
301 0.16
302 0.16
303 0.15
304 0.12
305 0.1
306 0.1
307 0.1
308 0.09
309 0.09
310 0.08
311 0.06
312 0.06
313 0.06
314 0.06
315 0.07
316 0.08
317 0.07
318 0.07
319 0.07
320 0.07
321 0.08
322 0.07
323 0.06
324 0.06
325 0.07
326 0.08
327 0.1
328 0.1
329 0.1
330 0.11
331 0.11
332 0.11
333 0.11
334 0.13
335 0.12
336 0.14
337 0.13
338 0.14
339 0.14
340 0.14
341 0.13
342 0.11
343 0.1
344 0.09
345 0.1
346 0.11
347 0.14
348 0.14
349 0.16
350 0.18
351 0.19
352 0.24
353 0.25
354 0.33
355 0.36
356 0.36
357 0.36
358 0.38
359 0.38
360 0.32
361 0.29
362 0.21
363 0.15
364 0.14
365 0.12
366 0.09
367 0.11
368 0.13
369 0.16
370 0.16
371 0.15
372 0.16
373 0.18
374 0.2
375 0.2
376 0.19
377 0.16
378 0.16
379 0.15
380 0.13
381 0.16
382 0.14
383 0.13
384 0.19
385 0.19
386 0.2
387 0.22
388 0.26
389 0.25
390 0.29
391 0.37
392 0.37
393 0.39
394 0.41
395 0.42
396 0.44