Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JSA7

Protein Details
Accession A0A367JSA7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-110VTPRTLQHKRHRQAIKRRRTEASHydrophilic
119-146QLLAKRVKEAKDKKIERRRTSSMQKSASHydrophilic
NLS Segment(s)
PositionSequence
38-50KRLGPKRASKIRK
66-137RREVTPKNGKKAYTKAPKIQRLVTPRTLQHKRHRQAIKRRRTEASREAESEYKQLLAKRVKEAKDKKIERRR
Subcellular Location(s) mito 14, nucl 7, cyto_nucl 5.5, cyto 2, plas 1, extr 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences RKSVRGCIVGSDLAVLSLVVVKQGEQEIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYVIRREVTPKNGKKAYTKAPKIQRLVTPRTLQHKRHRQAIKRRRTEASREAESEYKQLLAKRVKEAKDKKIERRRTSSMQKSASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.1
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.08
10 0.1
11 0.1
12 0.09
13 0.1
14 0.1
15 0.11
16 0.11
17 0.1
18 0.09
19 0.12
20 0.14
21 0.17
22 0.22
23 0.21
24 0.23
25 0.32
26 0.38
27 0.43
28 0.48
29 0.53
30 0.58
31 0.68
32 0.75
33 0.75
34 0.78
35 0.76
36 0.78
37 0.75
38 0.71
39 0.69
40 0.66
41 0.61
42 0.57
43 0.55
44 0.5
45 0.44
46 0.41
47 0.34
48 0.3
49 0.29
50 0.28
51 0.29
52 0.28
53 0.3
54 0.36
55 0.4
56 0.45
57 0.53
58 0.52
59 0.52
60 0.53
61 0.52
62 0.49
63 0.47
64 0.49
65 0.5
66 0.51
67 0.52
68 0.58
69 0.63
70 0.62
71 0.6
72 0.56
73 0.53
74 0.54
75 0.52
76 0.46
77 0.44
78 0.5
79 0.54
80 0.56
81 0.59
82 0.64
83 0.63
84 0.69
85 0.73
86 0.74
87 0.77
88 0.8
89 0.81
90 0.79
91 0.8
92 0.77
93 0.74
94 0.72
95 0.7
96 0.67
97 0.61
98 0.54
99 0.52
100 0.48
101 0.44
102 0.39
103 0.3
104 0.24
105 0.22
106 0.22
107 0.27
108 0.31
109 0.34
110 0.41
111 0.48
112 0.52
113 0.6
114 0.66
115 0.68
116 0.72
117 0.77
118 0.78
119 0.81
120 0.86
121 0.85
122 0.85
123 0.83
124 0.82
125 0.84
126 0.84
127 0.83