Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KTF3

Protein Details
Accession A0A367KTF3   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-97LDEKKMKQKTSKPANRQYHRKQNREAIKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLNLITRSKSISPIARVSHLHTTSILYNNTIVSSAPKGTVLKGIQFLKDKPEPIALDDSEYPEWLWNLLDEKKMKQKTSKPANRQYHRKQNREAIKASNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.4
4 0.41
5 0.45
6 0.39
7 0.35
8 0.3
9 0.29
10 0.28
11 0.31
12 0.27
13 0.18
14 0.18
15 0.17
16 0.17
17 0.14
18 0.11
19 0.09
20 0.1
21 0.1
22 0.1
23 0.11
24 0.12
25 0.12
26 0.17
27 0.15
28 0.15
29 0.2
30 0.2
31 0.22
32 0.24
33 0.24
34 0.24
35 0.26
36 0.25
37 0.21
38 0.24
39 0.21
40 0.2
41 0.23
42 0.17
43 0.17
44 0.16
45 0.18
46 0.14
47 0.14
48 0.12
49 0.1
50 0.1
51 0.08
52 0.08
53 0.06
54 0.09
55 0.1
56 0.15
57 0.16
58 0.2
59 0.29
60 0.34
61 0.36
62 0.41
63 0.48
64 0.54
65 0.64
66 0.7
67 0.71
68 0.77
69 0.85
70 0.86
71 0.89
72 0.89
73 0.89
74 0.89
75 0.87
76 0.84
77 0.83
78 0.83
79 0.8
80 0.73
81 0.69
82 0.64
83 0.63
84 0.57
85 0.56
86 0.49