Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JM77

Protein Details
Accession A0A367JM77    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KPSSSSGGKKAKKKWSAKKVKDKANNLVIHydrophilic
NLS Segment(s)
PositionSequence
11-30SSSSGGKKAKKKWSAKKVKD
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNLVILDQPTHDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKAVSRHHAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.47
4 0.52
5 0.58
6 0.64
7 0.71
8 0.79
9 0.81
10 0.82
11 0.87
12 0.89
13 0.91
14 0.9
15 0.9
16 0.89
17 0.84
18 0.81
19 0.76
20 0.69
21 0.58
22 0.51
23 0.42
24 0.34
25 0.28
26 0.2
27 0.14
28 0.13
29 0.13
30 0.13
31 0.12
32 0.12
33 0.15
34 0.15
35 0.2
36 0.22
37 0.23
38 0.26
39 0.28
40 0.26
41 0.28
42 0.28
43 0.22
44 0.19
45 0.2
46 0.18
47 0.2
48 0.2
49 0.16
50 0.16
51 0.17
52 0.17
53 0.15
54 0.15
55 0.12
56 0.14
57 0.14
58 0.15
59 0.14
60 0.14
61 0.14
62 0.14
63 0.13
64 0.13
65 0.12
66 0.12
67 0.11
68 0.12
69 0.11
70 0.11
71 0.09
72 0.11
73 0.11
74 0.11