Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J7B5

Protein Details
Accession A0A367J7B5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
189-215KEDAWFCPQCKKKRKATKQLTLSRLPDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
Pfam View protein in Pfam  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS50235  USP_3  
CDD cd02674  Peptidase_C19R  
Amino Acid Sequences MRPAPPAQAKLQRRRTFIDNPFNGFTTTTSKLYDVPPVPTVATSGTKKVQQKPPSMEPADAIIKFAPRFSGTDQHDSQEFLTFLLDGIHEDVNLARKPMQEIEYDNLPDWQASAMSWERYLTRHTSIVVSLFQGQYQSRLICSSCKHTSTTYTPFMSLSLPIPAKRLKITNVTLYQCLDFFVKEEILEKEDAWFCPQCKKKRKATKQLTLSRLPDVLLIHLKRFSADGLFKNKLDTMVKYPTRGFDLYGYVSKFIPPKQSSAQDRASSTYDLYAVSVRNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.71
4 0.71
5 0.72
6 0.66
7 0.64
8 0.62
9 0.58
10 0.52
11 0.42
12 0.34
13 0.3
14 0.29
15 0.24
16 0.23
17 0.23
18 0.24
19 0.25
20 0.32
21 0.28
22 0.27
23 0.27
24 0.27
25 0.27
26 0.24
27 0.23
28 0.18
29 0.22
30 0.2
31 0.22
32 0.24
33 0.3
34 0.37
35 0.45
36 0.52
37 0.54
38 0.61
39 0.65
40 0.69
41 0.72
42 0.67
43 0.58
44 0.5
45 0.46
46 0.42
47 0.34
48 0.28
49 0.19
50 0.2
51 0.2
52 0.19
53 0.17
54 0.13
55 0.15
56 0.17
57 0.25
58 0.27
59 0.34
60 0.34
61 0.34
62 0.33
63 0.32
64 0.29
65 0.24
66 0.2
67 0.13
68 0.12
69 0.1
70 0.09
71 0.09
72 0.08
73 0.05
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.12
80 0.12
81 0.12
82 0.12
83 0.13
84 0.15
85 0.18
86 0.19
87 0.16
88 0.19
89 0.21
90 0.22
91 0.22
92 0.21
93 0.18
94 0.16
95 0.14
96 0.12
97 0.09
98 0.06
99 0.05
100 0.08
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.11
107 0.14
108 0.13
109 0.14
110 0.15
111 0.15
112 0.15
113 0.15
114 0.15
115 0.14
116 0.12
117 0.11
118 0.1
119 0.09
120 0.1
121 0.1
122 0.1
123 0.11
124 0.1
125 0.09
126 0.1
127 0.1
128 0.12
129 0.13
130 0.18
131 0.19
132 0.21
133 0.22
134 0.22
135 0.26
136 0.29
137 0.33
138 0.3
139 0.28
140 0.27
141 0.25
142 0.25
143 0.21
144 0.16
145 0.11
146 0.12
147 0.12
148 0.12
149 0.14
150 0.16
151 0.17
152 0.18
153 0.19
154 0.18
155 0.24
156 0.26
157 0.3
158 0.34
159 0.35
160 0.34
161 0.32
162 0.3
163 0.23
164 0.22
165 0.15
166 0.1
167 0.09
168 0.1
169 0.09
170 0.09
171 0.11
172 0.11
173 0.12
174 0.13
175 0.12
176 0.14
177 0.15
178 0.16
179 0.17
180 0.19
181 0.18
182 0.26
183 0.34
184 0.41
185 0.5
186 0.57
187 0.64
188 0.73
189 0.83
190 0.86
191 0.88
192 0.89
193 0.89
194 0.9
195 0.86
196 0.81
197 0.72
198 0.63
199 0.53
200 0.42
201 0.34
202 0.25
203 0.22
204 0.23
205 0.22
206 0.21
207 0.22
208 0.22
209 0.2
210 0.2
211 0.18
212 0.16
213 0.2
214 0.24
215 0.3
216 0.33
217 0.33
218 0.34
219 0.34
220 0.33
221 0.31
222 0.29
223 0.27
224 0.34
225 0.36
226 0.37
227 0.38
228 0.37
229 0.39
230 0.36
231 0.32
232 0.24
233 0.26
234 0.26
235 0.3
236 0.28
237 0.25
238 0.24
239 0.26
240 0.27
241 0.26
242 0.32
243 0.3
244 0.34
245 0.4
246 0.49
247 0.53
248 0.56
249 0.61
250 0.56
251 0.56
252 0.54
253 0.5
254 0.42
255 0.36
256 0.31
257 0.23
258 0.19
259 0.18
260 0.17