Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KTN7

Protein Details
Accession A0A367KTN7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-35LISRGYCARKKLRKTKRIHFRLENIPNTHydrophilic
NLS Segment(s)
PositionSequence
17-24KKLRKTKR
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
Amino Acid Sequences MVPENFILISRGYCARKKLRKTKRIHFRLENIPNTKVIYSRPTILCKRPAIDSDSDSDGTYQPLSTSSSDSTKQPANSYLYLVGAGSDNYIPPTNAKKKMVMKAVKAYKETIRQDGNDYDMCLPSFGIPNSTRRRLDYDPTMEHDPTRLARTYPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.51
4 0.61
5 0.69
6 0.74
7 0.79
8 0.85
9 0.88
10 0.89
11 0.89
12 0.88
13 0.85
14 0.81
15 0.82
16 0.81
17 0.79
18 0.72
19 0.64
20 0.56
21 0.49
22 0.42
23 0.33
24 0.26
25 0.22
26 0.2
27 0.25
28 0.27
29 0.32
30 0.37
31 0.41
32 0.45
33 0.43
34 0.42
35 0.39
36 0.38
37 0.35
38 0.33
39 0.29
40 0.25
41 0.25
42 0.24
43 0.21
44 0.2
45 0.16
46 0.14
47 0.13
48 0.1
49 0.07
50 0.07
51 0.09
52 0.09
53 0.1
54 0.11
55 0.13
56 0.14
57 0.15
58 0.17
59 0.18
60 0.18
61 0.17
62 0.19
63 0.2
64 0.19
65 0.19
66 0.17
67 0.14
68 0.13
69 0.12
70 0.09
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.06
77 0.06
78 0.06
79 0.08
80 0.16
81 0.22
82 0.28
83 0.29
84 0.35
85 0.41
86 0.47
87 0.54
88 0.52
89 0.49
90 0.53
91 0.58
92 0.55
93 0.5
94 0.47
95 0.43
96 0.46
97 0.45
98 0.42
99 0.38
100 0.35
101 0.38
102 0.36
103 0.35
104 0.28
105 0.27
106 0.22
107 0.2
108 0.19
109 0.15
110 0.14
111 0.12
112 0.14
113 0.12
114 0.16
115 0.17
116 0.26
117 0.34
118 0.41
119 0.41
120 0.41
121 0.48
122 0.47
123 0.53
124 0.53
125 0.53
126 0.5
127 0.54
128 0.56
129 0.49
130 0.45
131 0.39
132 0.34
133 0.29
134 0.3
135 0.26
136 0.23