Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JBZ4

Protein Details
Accession A0A367JBZ4    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-73DIPPPDTPRACRRNPRPTPEPKKEKKAPKRMRLDSPGPVKKTKPAWRPRRRIIVESBasic
114-134SFSITKKKSPRRSKSVFTKDTHydrophilic
NLS Segment(s)
PositionSequence
29-68RRNPRPTPEPKKEKKAPKRMRLDSPGPVKKTKPAWRPRRR
119-190KKKSPRRSKSVFTKDTPKFKKTATNHKSNSEKKTKNRGKMGLKEEISKKPKKVSTKEPTKEPTKEPSKEPKK
254-286KEPAKEPAKEPAKEPAKEPAKEPAREPAREPAR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences LSRRKRELNRLKFEGIEDIPPPDTPRACRRNPRPTPEPKKEKKAPKRMRLDSPGPVKKTKPAWRPRRRIIVESESSSSEEFDHSDSSITVYDYSTDSLSDSSSGYSSGSSIDESFSITKKKSPRRSKSVFTKDTPKFKKTATNHKSNSEKKTKNRGKMGLKEEISKKPKKVSTKEPTKEPTKEPSKEPKKEPMTETMIEPTTEPTKEPTKEPTKEPTKELSEEPAKELSEEPVKEPAKELSEEPAKELSEEPAKEPAKEPAKEPAKEPAKEPAKEPAREPAREPARELVKNIIKKVTLSFSSKKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.48
3 0.41
4 0.32
5 0.28
6 0.26
7 0.25
8 0.27
9 0.25
10 0.26
11 0.28
12 0.38
13 0.43
14 0.51
15 0.61
16 0.68
17 0.74
18 0.81
19 0.84
20 0.83
21 0.86
22 0.88
23 0.89
24 0.89
25 0.87
26 0.88
27 0.89
28 0.9
29 0.9
30 0.91
31 0.91
32 0.9
33 0.91
34 0.88
35 0.88
36 0.86
37 0.81
38 0.78
39 0.78
40 0.76
41 0.69
42 0.66
43 0.58
44 0.56
45 0.6
46 0.61
47 0.6
48 0.63
49 0.7
50 0.77
51 0.85
52 0.87
53 0.89
54 0.84
55 0.78
56 0.76
57 0.73
58 0.67
59 0.6
60 0.53
61 0.43
62 0.4
63 0.35
64 0.27
65 0.19
66 0.14
67 0.11
68 0.11
69 0.1
70 0.09
71 0.1
72 0.09
73 0.1
74 0.1
75 0.1
76 0.09
77 0.08
78 0.09
79 0.09
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.08
101 0.09
102 0.1
103 0.12
104 0.12
105 0.17
106 0.25
107 0.35
108 0.44
109 0.54
110 0.62
111 0.69
112 0.75
113 0.79
114 0.82
115 0.82
116 0.77
117 0.7
118 0.7
119 0.66
120 0.7
121 0.67
122 0.58
123 0.49
124 0.45
125 0.51
126 0.47
127 0.52
128 0.49
129 0.53
130 0.54
131 0.58
132 0.66
133 0.62
134 0.65
135 0.63
136 0.64
137 0.61
138 0.7
139 0.71
140 0.7
141 0.71
142 0.71
143 0.68
144 0.7
145 0.67
146 0.63
147 0.57
148 0.54
149 0.52
150 0.52
151 0.51
152 0.47
153 0.44
154 0.44
155 0.48
156 0.51
157 0.53
158 0.56
159 0.59
160 0.66
161 0.68
162 0.68
163 0.69
164 0.67
165 0.64
166 0.57
167 0.56
168 0.53
169 0.52
170 0.52
171 0.57
172 0.6
173 0.63
174 0.64
175 0.65
176 0.63
177 0.65
178 0.61
179 0.57
180 0.52
181 0.47
182 0.43
183 0.36
184 0.3
185 0.26
186 0.23
187 0.19
188 0.16
189 0.15
190 0.14
191 0.15
192 0.21
193 0.22
194 0.24
195 0.31
196 0.37
197 0.41
198 0.44
199 0.5
200 0.53
201 0.54
202 0.55
203 0.53
204 0.48
205 0.48
206 0.45
207 0.43
208 0.4
209 0.38
210 0.37
211 0.33
212 0.28
213 0.27
214 0.26
215 0.22
216 0.22
217 0.22
218 0.22
219 0.28
220 0.29
221 0.28
222 0.29
223 0.28
224 0.25
225 0.26
226 0.25
227 0.24
228 0.3
229 0.3
230 0.3
231 0.3
232 0.26
233 0.26
234 0.26
235 0.23
236 0.23
237 0.23
238 0.23
239 0.29
240 0.3
241 0.31
242 0.32
243 0.36
244 0.38
245 0.38
246 0.39
247 0.4
248 0.48
249 0.47
250 0.48
251 0.49
252 0.49
253 0.49
254 0.49
255 0.49
256 0.49
257 0.49
258 0.49
259 0.5
260 0.49
261 0.5
262 0.5
263 0.5
264 0.49
265 0.5
266 0.52
267 0.52
268 0.52
269 0.52
270 0.53
271 0.51
272 0.53
273 0.53
274 0.52
275 0.51
276 0.51
277 0.54
278 0.54
279 0.51
280 0.43
281 0.42
282 0.44
283 0.42
284 0.38
285 0.4
286 0.43