Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K4M4

Protein Details
Accession A0A367K4M4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
37-70VPLKKSGKGKSPKSPRTKKRKGRGKKNTTYSLEABasic
NLS Segment(s)
PositionSequence
40-62KKSGKGKSPKSPRTKKRKGRGKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 5
Family & Domain DBs
Amino Acid Sequences MTLYILDNDFLSAQVIPVQKSVDDDFQAPIVSAFNYVPLKKSGKGKSPKSPRTKKRKGRGKKNTTYSLEAPEEKQGLCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.14
5 0.14
6 0.13
7 0.16
8 0.18
9 0.16
10 0.16
11 0.16
12 0.16
13 0.15
14 0.15
15 0.12
16 0.1
17 0.08
18 0.07
19 0.07
20 0.06
21 0.09
22 0.11
23 0.11
24 0.12
25 0.15
26 0.17
27 0.18
28 0.27
29 0.28
30 0.35
31 0.44
32 0.49
33 0.57
34 0.66
35 0.72
36 0.75
37 0.81
38 0.82
39 0.85
40 0.89
41 0.89
42 0.89
43 0.91
44 0.91
45 0.92
46 0.93
47 0.93
48 0.92
49 0.91
50 0.9
51 0.84
52 0.8
53 0.71
54 0.66
55 0.6
56 0.52
57 0.45
58 0.4
59 0.37