Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KP79

Protein Details
Accession A0A367KP79    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-48KEEEKEKQCKRRLVQKKRRGNLPKCVTBasic
NLS Segment(s)
PositionSequence
37-39KKR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
IPR008422  Homeobox_KN_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05920  Homeobox_KN  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences METNKKKKKTDDDDDDDDNGEKEEEKEKQCKRRLVQKKRRGNLPKCVTAILKQWLIDHHKHPYPTEEEKRALGLKTDLTLNQISNWFINARRRILPFILSQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.66
3 0.56
4 0.47
5 0.36
6 0.26
7 0.18
8 0.13
9 0.11
10 0.15
11 0.19
12 0.23
13 0.32
14 0.39
15 0.49
16 0.56
17 0.62
18 0.63
19 0.68
20 0.75
21 0.77
22 0.81
23 0.81
24 0.84
25 0.82
26 0.86
27 0.86
28 0.81
29 0.8
30 0.76
31 0.71
32 0.61
33 0.57
34 0.48
35 0.39
36 0.37
37 0.3
38 0.24
39 0.19
40 0.18
41 0.2
42 0.24
43 0.25
44 0.23
45 0.26
46 0.27
47 0.28
48 0.29
49 0.29
50 0.31
51 0.37
52 0.4
53 0.39
54 0.38
55 0.38
56 0.39
57 0.37
58 0.31
59 0.24
60 0.19
61 0.16
62 0.15
63 0.16
64 0.14
65 0.15
66 0.16
67 0.15
68 0.15
69 0.16
70 0.16
71 0.15
72 0.16
73 0.15
74 0.18
75 0.26
76 0.3
77 0.33
78 0.37
79 0.4
80 0.43
81 0.44
82 0.43
83 0.42